CAZyme Information: MGYG000000227_03353

Basic Information

• Species: Bacillus sonorensis
• Lineage: Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus; Bacillus sonorensis
• CAZyme ID: MGYG000000227_03353
• CAZy Family: CBM50
• CAZyme Description: Trifunctional nucleotide phosphoesterase protein YfkN

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1440	MGYG000000227_7|CGC3	158181.94	6.2178

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000227	4782975	Isolate	China	Asia

• Gene Location: Start: 78250; End: 82572 Strand: +

Full Sequence      

MVGIQKRRFLVLRILLASVMIFSILIPNTQIHAEEHSEHPLVKLSILGTTDIHAHIMDYD
YYADKATAAFGLARTAQLIQKYRSQNPNTLLVDNGDLIQGNPLGEYVFKHEREQITSRSK
IHPIIDVMNKLQYDAGTLGNHEFNYGLEFLDGTVKGAEFPIVNANIKTLDGRHKYKPYHI
EERTFSDENGQKHQLKVGYIGFVPPQILTWDKKHLDGKIKVQDITESAKEMVPKMKAEGA
DVIIAIAHTGIETKEQQAGAENAVYDLAVKAEGIDAIISGHQHGLFPGPDYAGNAKIDIQ
KGTINGIPVVMPKNWGSHLGIIDMQLEQKDGHWTVKDASAKTEAIAGNVGSQNETVTAAI
KDTHEKTLEYVRKPVGKTEADINSFFSQVKDDPSIQIVTDAQKWYAEDVMKDTEYKDLPI
LSAGAPFKAGGRNGPDYYTNIKAGGLAIKNIGDLYLYDNTLYIVKLNGREVKDWIEMSAG
QFNQIDPSKTEEQALLNQDYRSYNFDVIDGVTYQIDVTQPAKYDANGGLKNPQASRVKNL
AYNGKPVKDDQEFLIVTNNYRASGGGGFPHLTQDKVVYAAADENRQVLMNYIIEKGTINP
AADNNWSIAPIKGAEVTFESSLLAKPFAEKAKDIDFVRESANSGYGVYKLNFETDGAEPP
PNDDHWRLTVMHTNDTHAHLDDAARRAAKVKEIREQTENNILLDAGDVFSGDLYFTKWNG
LADLKLMNMMGYDAMTFGNHEFDKGPQVLADFLGGNGAAVDPANKHSFEAPSFPIVSANV
DVAKEPKLSRFQKKPAVLKAGARKETGIYPYILLDVNGEKVAVFGLTTEDTSYTSSPGAN
ITFHDAYSSAEKTVKEIKEKEKVNKIIALTHIGYNRDLELAKKVQGIDLIIGGHTHTLVD
HLEVVPNTEPTIVAQVKDYGQFLGRVDVAFDEDGIVQTDQSSFDLIAIDDHAAEEPDVKN
VLDDFKQELEDVKTERVGYADVPLDGKREHVRSKETNLGNFIADGMLRKARQAGGADIAI
TNGGGIRSGIDKGKITLGEVLTVMPFGNTLYAADMTGAQIKEALEHGVSQVEEGGGAFPH
VAGLTVTFTLNKPKGERILDVKLIDEKGTSRPLDPKKTYRVATNNFMGGGGDGYTVFKNA
KNGVDLGFSDYEIFTEQLKLYDSVSPNIENRITEVFLPDRQTNGTWTLKKEPFKTYAKNA
NKAIAYFPETEREDIRLNMTKAQTNLIKARPNDPSITLKNDKIAMQLPAANLADEETKIG
IRIGKNIKQAVTKVYDFSIQQNGKAVSSFKEPVGLFFQVDHPDKQAGVYHVDRKHNRFTK
VKNGYSKDHTAAGYVDHFSEYTVLHARHAGTPSAPPGSQDGSAGGERPDAPGGGSHNGGS
GNGSGHDGGNGGQAPADPANGSLPNTATTFYNWLMLGLLLLAAGGGLYLYQRKKRNINHM

Enzyme Prediction     

No EC number prediction in MGYG000000227_03353.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR01390	CycNucDiestase	0.0	42	653	1	625	2',3'-cyclic-nucleotide 2'-phosphodiesterase. 2',3'-cyclic-nucleotide 2'-phosphodiesterase is a bifunctional enzyme localized to the periplasm of Gram-negative bacteria. 2',3'-cyclic-nucleotide 2'-phosphodiesters are intermediates formed during the hydrolysis of RNA by the ribonuclease I, which is also found to the periplasm, and other enzymes of the RNAse T2 family. Bacteria are unable to transport 2',3'-cyclic-nucleotides into the cytoplasm. 2',3'-cyclic-nucleotide 2'-phosphodiesterase contains 2 active sites which catalyze the reactions that convert the 2',3'-cyclic-nucleotide into a 3'-nucleotide, which is then converted into nucleic acid and phosphate. Both final products can be transported into the cytoplasm. Thus, it has been suggested that 2',3'-cyclic-nucleotide 2'-phosphodiesterase has a 'scavenging' function. Experimental evidence indicates that 2',3'-cyclic-nucleotide 2'-phosphodiesterase enables Yersinia enterocolitica O:8 to grow on 2'3'-cAMP as a sole source of carbon and energy (). [Purines, pyrimidines, nucleosides, and nucleotides, Other]
PRK09420	cpdB	0.0	42	652	24	647	bifunctional 2',3'-cyclic-nucleotide 2'-phosphodiesterase/3'-nucleotidase.
PRK09419	PRK09419	0.0	6	1192	1	1163	multifunctional 2',3'-cyclic-nucleotide 2'-phosphodiesterase/3'-nucleotidase/5'-nucleotidase.
PRK09418	PRK09418	0.0	13	661	6	671	bifunctional 2',3'-cyclic-nucleotide 2'-phosphodiesterase/3'-nucleotidase.
PRK11907	PRK11907	0.0	17	665	91	738	bifunctional 2',3'-cyclic-nucleotide 2'-phosphodiesterase/3'-nucleotidase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QLG37215.1	3.23e-218	42	661	36	679
QOS76560.1	3.16e-217	42	661	36	679
APO43595.1	1.09e-216	42	661	34	677
QZN77538.1	3.23e-216	42	661	36	679
QKS58250.1	3.23e-216	42	660	36	671

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3GVE_A	7.83e-162	37	373	5	341	Crystalstructure of calcineurin-like phosphoesterase YfkN from Bacillus subtilis [Bacillus subtilis subsp. subtilis str. 168],3GVE_B Crystal structure of calcineurin-like phosphoesterase YfkN from Bacillus subtilis [Bacillus subtilis subsp. subtilis str. 168]
2Z1A_A	6.84e-107	668	1172	30	528	Crystalstructure of 5'-nucleotidase precursor from Thermus thermophilus HB8 [Thermus thermophilus HB8]
5EQV_A	2.97e-97	42	371	8	338	1.45Angstrom Crystal Structure of Bifunctional 2',3'-cyclic Nucleotide 2'-phosphodiesterase/3'-Nucleotidase Periplasmic Precursor Protein from Yersinia pestis with Phosphate bound to the Active site [Yersinia pestis CO92]
3JYF_A	1.94e-96	42	373	7	339	ChainA, 2',3'-cyclic nucleotide 2'-phosphodiesterase/3'-nucleotidase bifunctional periplasmic protein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578],3JYF_B Chain B, 2',3'-cyclic nucleotide 2'-phosphodiesterase/3'-nucleotidase bifunctional periplasmic protein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
4H2I_A	3.01e-75	666	1172	2	521	Humanecto-5'-nucleotidase (CD73): crystal form III (closed) in complex with AMPCP [Homo sapiens],6TVX_A Human CD73 (ecto 5'-nucleotidase) in complex with PSB12676 (an AOPCP derivative, compound 9 in paper) in the closed state [Homo sapiens],6TW0_A Human CD73 (ecto 5'-nucleotidase) in complex with PSB12690 (an AOPCP derivative, compound 10 in publication) in the closed state [Homo sapiens],6TWA_A Human CD73 (ecto 5'-nucleotidase) in complex with PSB12646 (an AOPCP derivative, compound 20 in publication) in the closed state [Homo sapiens],6TWF_A Human CD73 (ecto 5'-nucleotidase) in complex with PSB12604 (an AOPCP derivative, compound 21 in publication) in the closed state [Homo sapiens],6YE1_A Chain A, 5'-nucleotidase [Homo sapiens],6YE1_B Chain B, 5'-nucleotidase [Homo sapiens],6YE2_A Chain A, 5'-nucleotidase [Homo sapiens],6YE2_B Chain B, 5'-nucleotidase [Homo sapiens],6Z9B_A Human Ecto-5'-nucleotidase (CD73) in complex with AOPCP derivative A830 (compound 16 in publication) in the closed form (crystal form III) [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O34313	0.0	4	1436	3	1457	Trifunctional nucleotide phosphoesterase protein YfkN OS=Bacillus subtilis (strain 168) OX=224308 GN=yfkN PE=1 SV=1
P08331	6.22e-184	42	651	22	629	2',3'-cyclic-nucleotide 2'-phosphodiesterase/3'-nucleotidase OS=Escherichia coli (strain K12) OX=83333 GN=cpdB PE=1 SV=2
P26265	1.40e-181	42	651	22	644	2',3'-cyclic-nucleotide 2'-phosphodiesterase/3'-nucleotidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=cpdB PE=3 SV=2
P53052	1.23e-175	42	653	27	651	2',3'-cyclic-nucleotide 2'-phosphodiesterase/3'-nucleotidase OS=Yersinia enterocolitica OX=630 GN=cpdB PE=3 SV=1
P44764	2.28e-173	42	651	32	654	2',3'-cyclic-nucleotide 2'-phosphodiesterase/3'-nucleotidase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=cpdB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000747	0.998381	0.000270	0.000233	0.000183	0.000157

TMHMM  Annotations     

start	end
9	31
1408	1430