CAZyme Information: MGYG000000227_02880

Basic Information

• Species: Bacillus sonorensis
• Lineage: Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus; Bacillus sonorensis
• CAZyme ID: MGYG000000227_02880
• CAZy Family: GT83
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
716	MGYG000000227_5|CGC5	76295.36	9.6936

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000227	4782975	Isolate	China	Asia

• Gene Location: Start: 221622; End: 223772 Strand: -

Full Sequence      

MIKKRKIDIFLVLILLLSAALNLYGIWNSDTDNAYYTAAVTSMTQSFHNFFYASFDPGGF
VTVDKPPVALWVQTLFALVFGVHGWSVVLPEGIAEVISVALLYFIVKPTFGKTAARISAL
VMACTPIAVAVSHTNNVDSILVLCLMIATWMLFKAVRTGKISWLLASFFMVGVGFNVKML
QAYMVLPAFMLFYLIAAKTTIRKKIVSLITSVIVLAAVSVSWAVVVDSQPESSRPYIGSS
QTNSVLELAFGYNGVQRLTGQSGAGGGKAASDQTQKKSNQEQQSSTASSSSSSSNGQMTP
PSGGGPGGGRNGAGSFGTGTPGPLRLFQSELSGQASWLIPFVLFGIIALLITGLRGQRKF
NDTTNETIFWTMWLLPVAAFFSVAGFFHHYYLIMLAAPIAALSGTGWTALVRLYQEESGW
KKWLLPIGILLATAFELYILIPYISDIGITWIILVGAFGIITSCLLFFVKKGKPFSYYVS
LAALLGMLIGPFYWTTATLADGVNGMIPQAGPQSAQSFGGGGGKMNNGSRPPGFGSPTGQ
DGQTGNQPNSGNNRSTDSSSDQNSQNQNGGSSSKTDQGRPNGSRGGPGSGESVDKDLLSY
LEKHNTGEKYLFAVSNANSASSYIIKTGKAVMAMGGFSGSDPILTVDKLKKLVNNGEVKY
FMIGNGRGQDNSDITNWIKKHGTEIKKSEYSSSSSGDSSQSGGPGGNQTLYKVELD

Enzyme Prediction     

No EC number prediction in MGYG000000227_02880.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT83	8	260	2.2e-32	0.4351851851851852

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1807	ArnT	4.33e-57	3	517	2	446	4-amino-4-deoxy-L-arabinose transferase or related glycosyltransferase of PMT family [Cell wall/membrane/envelope biogenesis].
pfam13231	PMT_2	7.31e-36	64	215	1	152	Dolichyl-phosphate-mannose-protein mannosyltransferase. This family contains members that are not captured by pfam02366.
cd21118	dermokine	2.46e-04	526	590	251	303	dermokine. Dermokine, also known as epidermis-specific secreted protein SK30/SK89, is a skin-specific glycoprotein that may play a regulatory role in the crosstalk between barrier dysfunction and inflammation, and therefore play a role in inflammatory diseases such as psoriasis. Dermokine is one of the most highly expressed proteins in differentiating keratinocytes, found mainly in the spinous and granular layers of the epidermis, but also in the epithelia of the small intestine, macrophages of the lung, and endothelial cells of the lung. Mouse dermokine has been reported to be encoded by 22 exons, and its expression leads to alpha, beta, and gamma transcripts.
cd21118	dermokine	4.49e-04	508	590	206	288	dermokine. Dermokine, also known as epidermis-specific secreted protein SK30/SK89, is a skin-specific glycoprotein that may play a regulatory role in the crosstalk between barrier dysfunction and inflammation, and therefore play a role in inflammatory diseases such as psoriasis. Dermokine is one of the most highly expressed proteins in differentiating keratinocytes, found mainly in the spinous and granular layers of the epidermis, but also in the epithelia of the small intestine, macrophages of the lung, and endothelial cells of the lung. Mouse dermokine has been reported to be encoded by 22 exons, and its expression leads to alpha, beta, and gamma transcripts.
NF035936	agg_sub_LPXTH	6.66e-04	526	594	85	159	serine-rich aggregation substance UasX. Members of this protein family are repetitive, serine-rich surface proteins of the Firmicutes, found primarily in the genus Leuconostoc. The variant form of sortase signal, LPXTH, is replaced by LPXTG in members from some lineages, such as Weissella oryzae, and therefore recognizable. Some members of this family have the KxYKxGKxW type signal peptide as seen in the glycoprotein adhesin GspB, a substrate of the accessory Sec system for secretion. WOSG25_050600 from Weissella oryzae SG25 is identified in a publication as an unnamed aggregation substance, a conclusion supported by the sorting signals and composition reported here. We assign the gene symbol uasX (unnamed aggregation substance X) based on our evaluation of the family.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QHU89858.1	5.85e-63	11	685	275	889
QHU90800.1	1.14e-60	11	685	275	886
QJU08762.1	5.11e-59	11	685	274	895
QJU05422.1	1.07e-57	11	685	275	890
QJU10517.1	2.74e-57	11	685	275	892

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O34575	2.05e-227	3	694	4	673	Putative mannosyltransferase YkcB OS=Bacillus subtilis (strain 168) OX=224308 GN=ykcB PE=3 SV=2
P37483	7.31e-204	3	714	2	685	Putative mannosyltransferase YycA OS=Bacillus subtilis (strain 168) OX=224308 GN=yycA PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.857140	0.103681	0.019959	0.000771	0.000480	0.017985

TMHMM  Annotations     

start	end
9	27
84	106
140	159
179	197
204	226
335	354
367	384
389	411
423	442
447	469
476	498