CAZyme Information: MGYG000000227_02188

Basic Information

• Species: Bacillus sonorensis
• Lineage: Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus; Bacillus sonorensis
• CAZyme ID: MGYG000000227_02188
• CAZy Family: CBM50
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
253	MGYG000000227_4|CGC2	28988.53	9.5355

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000227	4782975	Isolate	China	Asia

• Gene Location: Start: 106433; End: 107194 Strand: +

Full Sequence      

MTEMSRIERKKKEREKAQAELARQTAPEPEIREDEIPSRQSYHEKKKNSKKKNKNRNPLF
TSLAVIFLFIPIIVFLVFMYMMNQGGTNPEQYDDVFYEKSGDTGFLNEKNGGDQEADQKA
DSEQKAAALQEKKQENSEKTDETPKKETAQEQPTEDKKTEDKPAAAENKPAVTAKKSEDK
SASTKKNTAKAPPVRQAPQPKKVIQHTVAEKETLYRISMKYYKDRSGEEKIRNYNQLSGN
NVYAGQVLDIPFY

Enzyme Prediction     

No EC number prediction in MGYG000000227_02188.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
NF033598	elast_bind_EbpS	6.52e-12	58	251	274	466	elastin-binding protein EbpS. The elastin-binding protein EbpS is an adhesin described in Staphylococcus aureus, with orthologs found in many additional staphylococcal species. EbpS is a membrane protein that lacks an N-terminal signal peptide region, has extensive regions low-complexity sequence rich in Asn and Gln, and has a C-terminal LysM domain.
pfam01476	LysM	2.97e-08	206	251	1	43	LysM domain. The LysM (lysin motif) domain is about 40 residues long. It is found in a variety of enzymes involved in bacterial cell wall degradation. This domain may have a general peptidoglycan binding function. The structure of this domain is known.
PRK13914	PRK13914	3.45e-07	101	250	129	243	invasion associated endopeptidase.
PTZ00121	PTZ00121	4.13e-07	114	212	1473	1575	MAEBL; Provisional
cd00118	LysM	2.06e-05	204	250	1	45	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ASB88675.1	1.32e-154	1	253	1	253
ATH92201.1	6.08e-77	1	253	1	251
SCA86534.1	6.08e-77	1	253	1	251
QAT65850.1	6.08e-77	1	253	1	251
AVI45926.1	1.77e-70	1	253	1	259

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P50731	4.61e-30	1	251	1	236	Uncharacterized protein YpbE OS=Bacillus subtilis (strain 168) OX=224308 GN=ypbE PE=4 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999751	0.000260	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
59	81