CAZyme Information: MGYG000000227_01461

Basic Information

• Species: Bacillus sonorensis
• Lineage: Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus; Bacillus sonorensis
• CAZyme ID: MGYG000000227_01461
• CAZy Family: GH18
• CAZyme Description: Spore germination protein YaaH

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
346	MGYG000000227_2|CGC12	39120.71	4.699

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000227	4782975	Isolate	China	Asia

• Gene Location: Start: 459254; End: 460294 Strand: +

Full Sequence      

MTMKKKLWVCMALSAIIVFFTYAKADAAEKMVLGYTTWDAASDQSLAAHHEYINSIATDT
FAFNENGNIIGDSPDNQLALAKKYNIKTWAVISNYSEAIQDFDGDLASKVMKNATIKKRF
ASQLVKLAKEHGYHGVNIDFEAVFPNERADYSSFIQYVADTLKKEQIQTMVSVPAKSADD
QEDEWSWPYDYAKIGRAADYVQVMTYDEHGSWSEPGSVASMGWITSSLDFAVQEIRADKV
VMGIPAYGYDWDETNQENNTMKQWNEIQSLIKETGARPVYDKQTASMTFSYVDQKGHQHV
VWYENEDTVEMKSRLSVEYQIAGVSVYALGHESESFWQAVQKGTKS

Enzyme Prediction     

No EC number prediction in MGYG000000227_01461.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	30	333	2.3e-42	0.9391891891891891

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd02874	GH18_CFLE_spore_hydrolase	6.14e-110	30	337	2	310	Cortical fragment-lytic enzyme (CFLE) is a peptidoglycan hydrolase involved in bacterial endospore germination. CFLE is expressed as an inactive preprotein (called SleB) in the forespore compartment of sporulating cells. SleB translocates across the forespore inner membrane and is deposited as a mature enzyme in the cortex layer of the spore. As part of a sensory mechanism capable of initiating germination, CFLE degrades a spore-specific peptidoglycan constituent called muramic-acid delta-lactam that comprises the outer cortex. CFLE has a C-terminal glycosyl hydrolase family 18 (GH18) catalytic domain as well as two N-terminal LysM peptidoglycan-binding domains. In addition to SleB, this family includes YaaH, YdhD, and YvbX from Bacillus subtilis.
COG3858	YaaH	1.17e-106	20	341	92	419	Spore germination protein YaaH [Cell cycle control, cell division, chromosome partitioning].
smart00636	Glyco_18	1.66e-35	61	330	31	332	Glyco_18 domain.
cd06549	GH18_trifunctional	4.94e-35	35	337	6	298	GH18 domain of an uncharacterized family of bacterial proteins, which share a common three-domain architecture: an N-terminal glycosyl hydrolase family 18 (GH18) domain, a glycosyl transferase family 2 domain, and a C-terminal polysaccharide deacetylase domain.
pfam00704	Glyco_hydro_18	2.06e-32	52	330	30	305	Glycosyl hydrolases family 18.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ASB87218.1	3.40e-256	1	346	1	346
QHZ45468.1	1.56e-194	3	345	1	343
AMA53908.1	1.14e-166	3	345	1	344
QNS19631.1	2.66e-165	3	345	1	344
QVN27024.1	5.37e-165	3	345	1	344

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5JH8_A	5.50e-58	32	343	4	313	Crystalstructure of chitinase from Chromobacterium violaceum ATCC 12472 [Chromobacterium violaceum ATCC 12472]
4Q6T_A	6.37e-46	28	346	3	341	Thecrystal structure of a class V chitininase from Pseudomonas fluorescens Pf-5 [Pseudomonas protegens Pf-5]
4S3K_A	4.14e-34	42	345	124	428	ChainA, Spore germination protein YaaH [Priestia megaterium QM B1551]
3CZ8_A	1.02e-33	52	329	32	308	ChainA, Putative sporulation-specific glycosylase ydhD [Bacillus subtilis subsp. subtilis str. 168],3CZ8_B Chain B, Putative sporulation-specific glycosylase ydhD [Bacillus subtilis subsp. subtilis str. 168]
4S3J_A	6.35e-30	91	338	172	419	Crystalstructure of the Bacillus cereus spore cortex-lytic enzyme SleL [Bacillus cereus ATCC 10876],4S3J_B Crystal structure of the Bacillus cereus spore cortex-lytic enzyme SleL [Bacillus cereus ATCC 10876],4S3J_C Crystal structure of the Bacillus cereus spore cortex-lytic enzyme SleL [Bacillus cereus ATCC 10876]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O32258	3.56e-164	3	345	1	344	Uncharacterized glycosylase YvbX OS=Bacillus subtilis (strain 168) OX=224308 GN=yvbX PE=3 SV=1
P37531	4.21e-35	52	337	130	416	Cortical fragment-lytic enzyme OS=Bacillus subtilis (strain 168) OX=224308 GN=sleL PE=1 SV=2
O05495	2.41e-32	52	329	124	400	Putative sporulation-specific glycosylase YdhD OS=Bacillus subtilis (strain 168) OX=224308 GN=ydhD PE=1 SV=2
P0DPJ9	1.35e-30	48	338	127	418	Cortical fragment-lytic enzyme OS=Bacillus anthracis OX=1392 GN=sleL PE=2 SV=1
Q9K3E4	6.36e-29	91	338	171	418	Cortical fragment-lytic enzyme OS=Bacillus cereus OX=1396 GN=sleL PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000388	0.998857	0.000268	0.000170	0.000163	0.000154

TMHMM  Annotations     

start	end
7	23