CAZyme Information: MGYG000000227_01460

Basic Information

• Species: Bacillus sonorensis
• Lineage: Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus; Bacillus sonorensis
• CAZyme ID: MGYG000000227_01460
• CAZy Family: PL3
• CAZyme Description: Pectate lyase C

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
221	MGYG000000227_2|CGC12	23505.64	9.8149

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000227	4782975	Isolate	China	Asia

• Gene Location: Start: 458238; End: 458903 Strand: -

Full Sequence      

MKKLAGLVVLSGLVAGLCGQAFPEKASAAEVVHQTIVVEKGKTYDGKGQRFTAGPELGDG
SQKEGQKPIFKVEDGATLKNVVLGAPAADGVHTYGNASINNVVWEDVGEDALTVKQKGNV
TINGGSARLASDKIFQINKASTFTVKNFTADQGGKFIRQLGGSTFKTSVVIDSCTITNMK
EAIFRTDSSTSTVTMTNTRYSNVGKKWIGVKHVTEKNNQEF

Enzyme Prediction     

No EC number prediction in MGYG000000227_01460.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL3	30	200	2.5e-75	0.9826589595375722

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam03211	Pectate_lyase	2.30e-77	19	212	1	198	Pectate lyase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ASB87217.1	1.63e-155	1	221	1	221
ATH93400.1	5.23e-152	1	221	1	221
QAT67193.1	1.01e-149	1	221	1	221
SCA87962.1	1.01e-149	1	221	1	221
AGN38058.1	3.03e-133	1	221	2	222

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1EE6_A	4.56e-72	28	221	1	197	CrystalStructure Of Pectate Lyase From Bacillus Sp. Strain Ksm-P15. [Bacillus sp. KSM-P15]
4EW9_A	1.06e-57	31	191	9	168	Theliganded structure of C. bescii family 3 pectate lyase [Caldicellulosiruptor bescii DSM 6725],4EW9_B The liganded structure of C. bescii family 3 pectate lyase [Caldicellulosiruptor bescii DSM 6725]
3T9G_A	1.10e-57	31	191	10	169	Thecrystal structure of family 3 pectate lyase from Caldicellulosiruptor bescii [Caldicellulosiruptor bescii],3T9G_B The crystal structure of family 3 pectate lyase from Caldicellulosiruptor bescii [Caldicellulosiruptor bescii]
4Z03_A	1.14e-56	31	191	18	177	C.bescii Family 3 pectate lyase double mutant K108A in complex with trigalacturonic acid [Caldicellulosiruptor bescii DSM 6725],4Z03_B C. bescii Family 3 pectate lyase double mutant K108A in complex with trigalacturonic acid [Caldicellulosiruptor bescii DSM 6725]
4Z05_A	1.14e-56	31	191	18	177	C.bescii Family 3 pectate lyase mutant E84A [Caldicellulosiruptor bescii DSM 6725],4Z05_B C. bescii Family 3 pectate lyase mutant E84A [Caldicellulosiruptor bescii DSM 6725]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q65EF5	9.70e-133	1	221	1	221	Pectate lyase C OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46) OX=279010 GN=pelC PE=3 SV=2
O34310	1.24e-112	1	221	1	221	Pectate lyase C OS=Bacillus subtilis (strain 168) OX=224308 GN=pelC PE=1 SV=1
D3JTC1	6.41e-75	1	203	1	202	Pectate lyase A OS=Paenibacillus amylolyticus OX=1451 GN=pelA PE=1 SV=1
Q9X6Z2	4.88e-72	1	203	1	202	Pectate lyase A OS=Paenibacillus barcinonensis OX=198119 GN=pelA PE=1 SV=1
A1DBJ7	1.52e-22	21	183	33	198	Probable pectate lyase E OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=plyE PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000382	0.973879	0.024961	0.000279	0.000274	0.000209

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000227_01460.