CAZyme Information: MGYG000000226_01798

Basic Information

• Species: Lactococcus lactis
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Streptococcaceae; Lactococcus; Lactococcus lactis
• CAZyme ID: MGYG000000226_01798
• CAZy Family: GT4
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
680	MGYG000000226_5|CGC3	78510.04	7.1381

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000226	2362991	Isolate	China	Asia

• Gene Location: Start: 209174; End: 211216 Strand: +

Full Sequence      

MPTNLERMKYVLTKNPKLLVKAPGKILRKTRKHFHPLKSLQLQINKNKRKKTRRFNNYEN
PKRVLIYVIYENQPQLQSYKLFFLKALADLSDKVLIVLNSTLADTDVKKLEKFGQVISRE
NTGYDTAAFRHGILLLKDELSNFDELLLVNDTNVGPMTDLSAVFQKMSTQKLDFWGISYG
EKQADFTGFNPYGAIHEHLQSYFLVIEKNMFQTPEFLKYWENLSDTNSRNKAIGKHETVF
TKYFSELGFIHGAVAGNNEDSAMYIHPLTMLEKFDVPLVKYTAFSNDTDDKFAWQGLERK
TEVPDLINYIKNETEFPKEILDEVINTIKYTPHPKHILIIDGVENQIPQCTRYRVINKAE
QLRSFSHEVWTVNASDFQMGYAEYASQIIIYRTPYSEQFKQLIELAHKYNKPVFYDIDDL
VYDTSYTDQLDYVKTLGKEEKEAYDSGVRSYGKLMELCDAFITSTTDLKNELLKLGKPVY
LNRNLASEELISISEQAIAKTIKDKKKIKIGYFSGSITHNENFDLIRSAILKILKEFPQT
ELHLVGHLTIPDEMKNYKKQLIVHDFLDWTLLPSLVAEMDINLAPLVDNVFNRAKSEIKW
LEAALVGVTTVASDIGSFSEIITNETTGVLVADGMWYEQLKDLIDNKTKLEFLGNNAKRK
VISTYKTTKHKDEFIEAIHG

Enzyme Prediction     

No EC number prediction in MGYG000000226_01798.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam05045	RgpF	1.58e-49	94	319	1	229	Rhamnan synthesis protein F. This family consists of a group of proteins which are related to the Streptococcus rhamnose-glucose polysaccharide assembly protein (RgpF). Rhamnan backbones are found in several O polysaccharides of phytopathogenic bacteria and are regarded as pathogenic factors.
COG3754	RgpF	1.92e-34	62	318	2	256	Lipopolysaccharide biosynthesis protein [Cell wall/membrane/envelope biogenesis].
cd03794	GT4_WbuB-like	1.31e-29	330	665	37	381	Escherichia coli WbuB and similar proteins. This family is most closely related to the GT1 family of glycosyltransferases. WbuB in E. coli is involved in the biosynthesis of the O26 O-antigen. It has been proposed to function as an N-acetyl-L-fucosamine (L-FucNAc) transferase.
cd03801	GT4_PimA-like	7.45e-16	359	679	24	366	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
COG0438	RfaB	1.09e-12	388	678	87	374	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIS02783.1	0.0	1	680	1	680
QEA62153.1	0.0	8	680	1	673
QQF01203.1	0.0	8	680	1	673
QNL92992.1	0.0	8	680	1	673
AWN67001.1	0.0	8	680	1	673

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999955	0.000058	0.000008	0.000000	0.000000	0.000005

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000226_01798.