CAZyme Information: MGYG000000224_02920

Basic Information

• Species: Bacteroides sp003545565
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides sp003545565
• CAZyme ID: MGYG000000224_02920
• CAZy Family: GH3
• CAZyme Description: Beta-hexosaminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1012	MGYG000000224_12|CGC1	112291.74	8.5808

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000224	3747034	Isolate	China	Asia

• Gene Location: Start: 25343; End: 28381 Strand: +

Full Sequence      

MKRLLLFVLIIMGCCGRFASDAKLRPATPAVVLPVEPLLVKPVQDDVRCRQWVDSVLDKL
SLKERVGQLFIYTIAPYQDKRNKELLRKVVEDYKVGGLLFSGGLMQNQVMLTNEAQRMAD
VPLLITFDGEWGLSMRLKGTPVFPKNMVLGCIRNDSLLYEYGREMARQCRELGVQVNFAP
VADVNINPENPVINTRSFGENPVNVADKVIAYAKGLEDGGVLSVSKHFPGHGDTDVDSHN
ALPTLPFTRERLDSVELYPFKKAIQEGLGGIMVGHLEVPAFEETSGVPSSLSRSVVYDLL
TRELKFRGLIFTDALAMKGVSNNASLCLKALKAGNDLLLVPRRIKEEVDAVLAAVKSGEL
TEQAVEEKCRKVLTCKYALGLNKKPVVRLSGLGTRINTPYTRDLIHRLNMAAITVLGNAT
EVLPLDPAIGDVAVLNVGAATEIQPFIKQLSMYTHPVEFQLGKDLPEAGRKALREKLSKY
KRILVCVTEHRLAAYQSFFAEFAPEVPVVYVFFIPGKQLLQIHRGISVAEAVVLAHSSGD
DVQRQAAKILYADAVADGRLSASIGGLFAAGEGLDLSPQTEPHFVPEEHGMDSRLLAQID
TIAREGIREGAYPGCQVVILKDGKEMYNKAFGTYTWSTAKDKEATPVTPVSVYDMASLTK
TTATLLAVMKLYDKGRLNLTDRVSDYLPYLQDTDKRDITVRELLFHQSGLPSTLLFYQDA
IDKDSYDGTLFKARPDKLHPTRIGRQTWANPKFRFRPGLTSKARTDECTLQVCDSLWLNK
SFKKEYLQKIADTPLKDKRYRYSCVGFILLQQLVEARAGMPMDEYLAQEFYAPMGLRRTG
YLPLRFLPKEGIVPSSVDPFLRKTILQGFVHDESAAFQGGVSGNAGLFSTAEEVAQVYQM
LLNGGELNGKRYLSKETCRLFTTTVAKNSRRGLGFDKPDVQNTEKSPCAPSAPASVYGHT
GFTGTCAWVDPDNGLVYVFISNRIYPDAWNTKLLKLDIRGKIQEAMYQAILK

Enzyme Prediction     

EC	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	116	340	7.2e-56	0.9814814814814815

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00933	Glyco_hydro_3	3.54e-77	61	374	1	315	Glycosyl hydrolase family 3 N terminal domain.
COG1472	BglX	1.46e-75	60	439	1	364	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
PRK03642	PRK03642	8.41e-57	567	1010	6	431	putative periplasmic esterase; Provisional
pfam00144	Beta-lactamase	4.78e-48	599	988	1	313	Beta-lactamase. This family appears to be distantly related to pfam00905 and PF00768 D-alanyl-D-alanine carboxypeptidase.
COG1680	AmpC	1.40e-41	559	987	1	367	CubicO group peptidase, beta-lactamase class C family [Defense mechanisms].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT44551.1	0.0	1	1012	1	1012
QRQ48901.1	0.0	1	1012	1	1012
QUT62072.1	0.0	1	1011	1	1010
QQA30538.1	0.0	1	1011	1	1010
QUT65080.1	0.0	1	1011	1	1010

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6K5J_A	4.35e-63	60	421	11	381	Structureof a glycoside hydrolase family 3 beta-N-acetylglucosaminidase from Paenibacillus sp. str. FPU-7 [Paenibacillaceae]
3BMX_A	2.87e-58	54	430	36	452	Beta-N-hexosaminidase(YbbD) from Bacillus subtilis [Bacillus subtilis],3BMX_B Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3NVD_A Structure of YBBD in complex with pugnac [Bacillus subtilis],3NVD_B Structure of YBBD in complex with pugnac [Bacillus subtilis]
3LK6_A	8.35e-58	54	430	10	426	ChainA, Lipoprotein ybbD [Bacillus subtilis],3LK6_B Chain B, Lipoprotein ybbD [Bacillus subtilis],3LK6_C Chain C, Lipoprotein ybbD [Bacillus subtilis],3LK6_D Chain D, Lipoprotein ybbD [Bacillus subtilis]
4GYJ_A	1.46e-57	54	430	40	456	Crystalstructure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYJ_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYK_A Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168],4GYK_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168]
3SQL_A	5.86e-54	57	379	12	349	CrystalStructure of Glycoside Hydrolase from Synechococcus [Synechococcus sp. PCC 7002],3SQL_B Crystal Structure of Glycoside Hydrolase from Synechococcus [Synechococcus sp. PCC 7002],3SQM_A Crystal Structure of Glycoside Hydrolase from Synechococcus Complexed with N-acetyl-D-glucosamine [Synechococcus sp. PCC 7002],3SQM_B Crystal Structure of Glycoside Hydrolase from Synechococcus Complexed with N-acetyl-D-glucosamine [Synechococcus sp. PCC 7002],3SQM_C Crystal Structure of Glycoside Hydrolase from Synechococcus Complexed with N-acetyl-D-glucosamine [Synechococcus sp. PCC 7002],3SQM_D Crystal Structure of Glycoside Hydrolase from Synechococcus Complexed with N-acetyl-D-glucosamine [Synechococcus sp. PCC 7002]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P40406	1.57e-57	54	430	36	452	Beta-hexosaminidase OS=Bacillus subtilis (strain 168) OX=224308 GN=nagZ PE=1 SV=1
P48823	5.33e-44	86	425	55	425	Beta-hexosaminidase A OS=Pseudoalteromonas piscicida OX=43662 GN=cht60 PE=1 SV=1
P77619	1.14e-40	586	1010	30	431	Putative D-alanyl-D-alanine carboxypeptidase OS=Escherichia coli (strain K12) OX=83333 GN=yfeW PE=1 SV=2
O05213	1.08e-39	581	1010	33	440	N-acetylmuramyl-L-alanine amidase OS=Bacillus subtilis (strain 168) OX=224308 GN=amiE PE=1 SV=3
Q8XBJ0	1.72e-39	586	1010	30	431	Putative D-alanyl-D-alanine carboxypeptidase OS=Escherichia coli O157:H7 OX=83334 GN=yfeW PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000061	1.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000224_02920.