CAZyme Information: MGYG000000217_02608

Basic Information

• Species: Acetatifactor sp900066565
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Acetatifactor; Acetatifactor sp900066565
• CAZyme ID: MGYG000000217_02608
• CAZy Family: CE8
• CAZyme Description: Pectinesterase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
305	MGYG000000217_19|CGC1	33693.27	4.9356

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000217	3653823	Isolate	China	Asia

• Gene Location: Start: 32947; End: 33864 Strand: +

Full Sequence      

MTTIHVSKNDPSAFSTLQEAILSIDDRHDEAIRIEVAPGIYEEKLFIRKENIEIVGDDPL
TTVFRYGDGAKKPRPDASGEYGTFNTAVIFIAGKDITLRNLTIESTAGPGYLAGQALAVY
AAADRLSCYNCRFTGWQDTIFNGDPMTCNMKKLMLPDFFQASEVPIVHKFYRNYFKDCYV
CGDVDYIFGPNTAFFDHCEIHSIARVSEGKAYITAASTPAGQEFGLVFSHCRITGEEPDS
VYLGRPWRDCAKTAFICCELGDHICPEAGRTGEKFVQKCCQIILNMGTSVPVRTVPDAAL
SPDAL

Enzyme Prediction     

No EC number prediction in MGYG000000217_02608.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	4	268	1.4e-69	0.8159722222222222

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4677	PemB	1.42e-53	6	264	85	352	Pectin methylesterase and related acyl-CoA thioesterases [Carbohydrate transport and metabolism, Lipid transport and metabolism].
PLN02773	PLN02773	2.43e-44	4	255	7	232	pectinesterase
pfam01095	Pectinesterase	1.03e-39	6	267	4	240	Pectinesterase.
PLN02682	PLN02682	4.88e-35	3	255	70	297	pectinesterase family protein
PLN02432	PLN02432	1.65e-32	4	255	13	222	putative pectinesterase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCJ96886.1	3.46e-108	4	274	2	273
QOV20146.1	2.29e-66	6	264	4	259
BAV13196.1	4.19e-63	6	274	3	267
ADL51177.1	4.19e-63	6	274	3	267
AEI32806.1	4.99e-63	6	274	3	267

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5C1E_A	9.10e-20	14	271	19	247	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]
1GQ8_A	2.23e-19	14	266	19	246	Pectinmethylesterase from Carrot [Daucus carota]
5C1C_A	4.48e-19	14	271	19	247	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]
2NSP_A	7.43e-19	7	247	11	245	ChainA, Pectinesterase A [Dickeya dadantii 3937],2NSP_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NST_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NST_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT6_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT6_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT9_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT9_B Chain B, Pectinesterase A [Dickeya dadantii 3937]
1XG2_A	3.35e-17	6	266	7	242	ChainA, Pectinesterase 1 [Solanum lycopersicum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9LVQ0	5.14e-35	4	247	7	224	Pectinesterase 31 OS=Arabidopsis thaliana OX=3702 GN=PME31 PE=1 SV=1
Q9LY17	1.30e-27	4	270	67	300	Probable pectinesterase 50 OS=Arabidopsis thaliana OX=3702 GN=PME50 PE=2 SV=1
Q9FJ21	1.04e-25	6	266	262	498	Probable pectinesterase/pectinesterase inhibitor 58 OS=Arabidopsis thaliana OX=3702 GN=PME58 PE=2 SV=1
B2VPR8	2.45e-25	8	267	70	298	Pectinesterase 2 OS=Olea europaea OX=4146 PE=1 SV=1
Q43043	1.02e-24	14	267	69	297	Pectinesterase OS=Petunia integrifolia OX=4103 GN=PPE1 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000067	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000217_02608.