CAZyme Information: MGYG000000217_00514

Basic Information

• Species: Acetatifactor sp900066565
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Acetatifactor; Acetatifactor sp900066565
• CAZyme ID: MGYG000000217_00514
• CAZy Family: GH26
• CAZyme Description: Mannan endo-1,4-beta-mannosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
324	MGYG000000217_2|CGC2	38000.78	4.5863

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000217	3653823	Isolate	China	Asia

• Gene Location: Start: 183470; End: 184444 Strand: +

Full Sequence      

MKVEKEEKMTTADPKATKETVELWYYLHAVAGKQIITGQHTQTIPCEEIDYIRQVTGKEP
KLRGFELLAYSPNINYEDASPECIQEVEENKGTVETALQWARKQQEAGNGGILTFTFHWF
SPLEGRDKSFYTEHTDFDAKEVLKEGTPERAAFYHDMDVIEEILRRFQEERIPILWRPFH
ESYGTWFWWGAQGPEVARNLYHLMFDYYTGEKDLHNLLWVWNSDVPEAYPGDSYVDVVSM
DVYLPEYLPTDYAETYKKLVTATSRNKITALAEIGYLPDIELLQKSRIPWAYYMTWSKEF
CIGEKYNSVENLKKMYDSEYAVTL

Enzyme Prediction     

No EC number prediction in MGYG000000217_00514.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH26	13	324	4.1e-93	0.9867986798679867

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam02156	Glyco_hydro_26	4.70e-50	13	323	2	308	Glycosyl hydrolase family 26.
COG4124	ManB2	4.24e-16	172	276	180	297	Beta-mannanase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNM01251.1	1.41e-196	6	324	3	334
CBK82137.1	5.85e-156	26	323	19	311
AEB13973.1	3.88e-151	11	324	4	310
AZK45707.1	2.73e-125	9	324	4	314
QUL56288.1	2.17e-120	13	324	11	317

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6HPF_A	1.52e-56	10	323	5	306	Structureof Inactive E165Q mutant of fungal non-CBM carrying GH26 endo-b-mannanase from Yunnania penicillata in complex with alpha-62-61-di-galactosyl-mannotriose [Yunnania penicillata]
3ZM8_A	1.04e-55	13	324	147	444	ChainA, Gh26 Endo-beta-1,4-mannanase [Podospora anserina S mat+]
3WDQ_A	2.08e-45	14	324	37	349	Crystalstructure of beta-mannanase from a symbiotic protist of the termite Reticulitermes speratus [Symbiotic protist of Reticulitermes speratus],3WDR_A Crystal structure of beta-mannanase from a symbiotic protist of the termite Reticulitermes speratus complexed with gluco-manno-oligosaccharide [Symbiotic protist of Reticulitermes speratus]
6D2X_A	8.42e-36	12	323	5	330	Crystalstructure of the GH26 domain from PbGH26-GH5A endo-beta-mannanase/endo-beta-glucanase from Prevotella bryantii [Prevotella bryantii B14]
6Q75_A	5.73e-35	16	323	28	323	Thestructure of GH26A from Muricauda sp. MAR_2010_75 [Muricauda sp. MAR_2010_75],6Q75_B The structure of GH26A from Muricauda sp. MAR_2010_75 [Muricauda sp. MAR_2010_75]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
G2Q4H7	5.48e-58	13	324	176	473	Mannan endo-1,4-beta-mannosidase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=Man26A PE=1 SV=1
Q5AWB7	1.45e-50	13	324	30	347	Probable mannan endo-1,4-beta-mannosidase E OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=manE PE=3 SV=1
P49425	4.36e-50	12	323	147	453	Mannan endo-1,4-beta-mannosidase OS=Rhodothermus marinus (strain ATCC 43812 / DSM 4252 / R-10) OX=518766 GN=manA PE=1 SV=3
A2R6F5	5.25e-49	13	324	30	330	Mannan endo-1,4-beta-mannosidase man26A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=man26A PE=1 SV=1
P55296	2.31e-38	10	324	156	457	Mannan endo-1,4-beta-mannosidase A OS=Piromyces sp. OX=45796 GN=MANA PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000045	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000217_00514.