CAZyme Information: MGYG000000211_00035

Basic Information

• Species: Bacteroides sp900556215
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides sp900556215
• CAZyme ID: MGYG000000211_00035
• CAZy Family: CBM32
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
318	MGYG000000211_1|CGC2	34592.79	4.3189

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000211	6486320	Isolate	China	Asia

• Gene Location: Start: 57558; End: 58514 Strand: +

Full Sequence      

MKRNIFQLICWSLGVLLFLSACSDNDGSDTIYIPNAGALVKVNFYIEDEPYVETFTVKVT
AKHYPDLNPTGLSTDATIYLEADPDKVAEYNATKGTNYPVLPSSAYTVASSTVVKAGKVE
SEPISITINSKGNIEPFTEYLLPVSIVSAEGVATDHCCQTVYFLCRGAMDASNMELLDRT
GWTVLAASSEEPKEGDWGNGGLKEACIDGTINTFWSTAWEQSHPQPPHWITFDLGQSTYI
QGFTIQARKEGADGPKVVVLEVSDDGQSWTNVGEFKDIPAAGEYRSFLPQAATGRFVKLT
ITAVNGGPHVTVSEFNLF

Enzyme Prediction     

No EC number prediction in MGYG000000211_00035.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM32	188	315	1.2e-21	0.9516129032258065

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam08522	DUF1735	4.33e-22	28	151	2	118	Domain of unknown function (DUF1735). This domain of unknown function is found in a number of bacterial proteins including acylhydrolases. The structure of this domain has a beta-sandwich fold.
pfam00754	F5_F8_type_C	3.32e-18	187	307	4	118	F5/8 type C domain. This domain is also known as the discoidin (DS) domain family.
cd00057	FA58C	1.54e-07	207	308	29	135	Substituted updates: Jan 31, 2002
smart00231	FA58C	1.11e-06	207	318	28	137	Coagulation factor 5/8 C-terminal domain, discoidin domain. Cell surface-attached carbohydrate-binding domain, present in eukaryotes and assumed to have horizontally transferred to eubacterial genomes.
pfam17132	Glyco_hydro_106	1.46e-05	229	318	209	314	alpha-L-rhamnosidase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRP91314.1	3.06e-148	1	318	1	317
CAH06408.1	7.10e-148	1	318	5	321
QCT77259.1	7.10e-148	1	318	5	321
QUU05791.1	2.50e-147	1	318	1	317
CUA17310.1	2.50e-147	1	318	1	317

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3F2Z_A	3.07e-14	177	317	5	145	Crystalstructure of the C-terminal domain of a chitobiase (BF3579) from Bacteroides fragilis, Northeast Structural Genomics Consortium Target BfR260B [Bacteroides fragilis NCTC 9343]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000057	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000211_00035.