CAZyme Information: MGYG000000209_02175

Basic Information

• Species: Eubacterium_F sp003491505
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Eubacterium_F; Eubacterium_F sp003491505
• CAZyme ID: MGYG000000209_02175
• CAZy Family: GT2
• CAZyme Description: Teichoic acid poly(glycerol phosphate) polymerase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
402	MGYG000000209_17|CGC1	48759.55	6.5083

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000209	3107681	Isolate	China	Asia

• Gene Location: Start: 23781; End: 24989 Strand: -

Full Sequence      

MRKGIYHLVKQIVVLFYYLMCNLCPVKQNRIVFDSSLGKSYSGNPKHIYEYLMANGYDLN
WDCIWFYENEKYNIPGMSRQVRYGRLRYLYYMATAKVWVFDTRQPEFLLRRKGTYYIQTW
HGTPLKKLALDMEDVFMVGESDIDSYKEHFTKNVHTWDFLISQNPFSSETFRRAFDFHRE
MLEYGYPRNDILFWENTTEGIRSFKRKLGLPEDKKIILYAPTWRDDEFSEDDKYEFRPQI
SFEKLQKELGDEYIMIVKYHYLIMDAIDWSPYEGFIYHFDQSRDIAELFLVSDILITDYS
SVMFDYSILNRPMFFFAYDFYKYKNELRGFYFSYSKEMPGPISTTTDELIEDIHSYDYSV
YAQRYEKFKKKYNSIDDGRAASRVLHLMKQLIPSKRTDVYYE

Enzyme Prediction     

No EC number prediction in MGYG000000209_02175.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam04464	Glyphos_transf	2.04e-116	25	387	1	357	CDP-Glycerol:Poly(glycerophosphate) glycerophosphotransferase. Wall-associated teichoic acids are a heterogeneous class of phosphate-rich polymers that are covalently linked to the cell wall peptidoglycan of gram-positive bacteria. They consist of a main chain of phosphodiester-linked polyols and/or sugar moieties attached to peptidoglycan via a linkage unit. CDP-glycerol:poly(glycerophosphate) glycerophosphotransferase is responsible for the polymerization of the main chain of the teichoic acid by sequential transfer of glycerol-phosphate units from CDP-glycerol to the linkage unit lipid.
COG1887	TagB	3.10e-78	8	388	6	384	CDP-glycerol glycerophosphotransferase, TagB/SpsB family [Cell wall/membrane/envelope biogenesis, Lipid transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QHS23522.1	5.99e-120	25	385	345	705
ALQ70765.1	7.13e-116	2	385	329	706
AJG93766.1	2.21e-114	2	385	329	706
QQZ10349.1	5.71e-113	26	385	345	700
QOV10415.1	4.83e-112	25	385	347	703

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3L7I_A	1.49e-97	26	381	350	707	Structureof the Wall Teichoic Acid Polymerase TagF [Staphylococcus epidermidis RP62A],3L7I_B Structure of the Wall Teichoic Acid Polymerase TagF [Staphylococcus epidermidis RP62A],3L7I_C Structure of the Wall Teichoic Acid Polymerase TagF [Staphylococcus epidermidis RP62A],3L7I_D Structure of the Wall Teichoic Acid Polymerase TagF [Staphylococcus epidermidis RP62A]
3L7J_A	1.61e-96	26	381	350	707	ChainA, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7J_B Chain B, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7J_C Chain C, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7J_D Chain D, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7K_A Chain A, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7K_B Chain B, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7K_C Chain C, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7K_D Chain D, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7L_A Chain A, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7L_B Chain B, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7L_C Chain C, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7L_D Chain D, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A]
3L7M_A	4.46e-96	26	381	350	707	ChainA, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7M_B Chain B, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7M_C Chain C, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7M_D Chain D, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P13485	2.67e-103	18	386	371	740	Teichoic acid poly(glycerol phosphate) polymerase OS=Bacillus subtilis (strain 168) OX=224308 GN=tagF PE=1 SV=1
Q8RKI5	3.44e-98	23	385	26	389	Teichoic acid poly(glycerol phosphate) polymerase OS=Bacillus spizizenii (strain ATCC 23059 / NRRL B-14472 / W23) OX=655816 GN=tarF PE=1 SV=1
Q5HLM5	6.80e-97	26	381	350	707	Teichoic acid poly(glycerol phosphate) polymerase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) OX=176279 GN=tagF PE=1 SV=1
Q2G1C1	1.08e-92	28	384	27	383	Teichoic acid glycerol-phosphate transferase OS=Staphylococcus aureus (strain NCTC 8325 / PS 47) OX=93061 GN=tarF PE=1 SV=1
Q8RKJ2	4.30e-37	16	385	245	600	Teichoic acid poly(ribitol-phosphate) polymerase OS=Bacillus spizizenii (strain ATCC 23059 / NRRL B-14472 / W23) OX=655816 GN=tarL PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.288196	0.692779	0.017257	0.000576	0.000453	0.000729

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000209_02175.