CAZyme Information: MGYG000000206_02495

Basic Information

• Species: Lachnoclostridium_B sp900066555
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Lachnoclostridium_B; Lachnoclostridium_B sp900066555
• CAZyme ID: MGYG000000206_02495
• CAZy Family: GH146
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
690	MGYG000000206_9|CGC1	79792.31	4.8063

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000206	2952936	Isolate	China	Asia

• Gene Location: Start: 87640; End: 89712 Strand: -

Full Sequence      

MNLSDQKVVQKDMDFLYLGNLKTVTFNLALPAKGKYGSEINWSSGEERFLDTDGRVNRPL
YGMGNREVLLTGTFTYGEATASKVYAVTILEQENPHQNADTYPIEVTVQGRPDKDAEVYQ
NAEAEIRILPGNAFYEAQEQMHKYLLSMDDDSMLYHFRKASGLDTRGADSPDGWDADESK
LKGHTTGHYLSALALCYRSTGDEKIRDKAVYMVDELGECQRAFQNIDGIREGFLSAYSEE
QFDLLEEYTPYPKIWAPYYTLHKIIAGLLDCYLYIDKKEALSIAEQMGVWTWHRLSQLPE
AQLKKMWSMYIAGEFGGMNVVMAQLAELTGREEFLKCAGLFDNDKLYRPLMHYRDQLNGI
HANQHIPQILGAIEIYKASGDLKYLEMARAFWTTVTENRTYATGGVGEGEMFQGYREIGK
LLTASTQETCASYNMLKLTRELYQMDPDSRYMDYYEKTLYNHILATPDESGSGESTYFFP
LGPGMKREFLFENSCCHGTGMESHFKYQEGMYFQKRDAFFINMYIPSEFSQDDMRLHMEC
VSQRRQEYELRIQNGTFRKLYLRYPEWADECLLEMDGEVLETKKNKAGYIEITMHSGDVK
LRIRWMPGWKVLRTPDEPEKAAIQYGPYIMAAISGEKEFLELPIKENEIADRAEWMDEYK
DGLAFRLGDWKWIPVYEVGDRAYHVYTIIK

Enzyme Prediction     

No EC number prediction in MGYG000000206_02495.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH146	131	631	4.4e-167	0.9880715705765407

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07944	Glyco_hydro_127	1.06e-113	125	631	1	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
COG3533	COG3533	4.93e-71	134	641	19	511	Uncharacterized conserved protein, DUF1680 family [Function unknown].
cd04792	LanM-like	3.45e-04	189	349	551	689	Cyclases involved in the biosynthesis of class II lantibiotics, and similar proteins. LanM-like proteins. LanM is a bifunctional enzyme, involved in the synthesis of class II lantibiotics. It is responsible for both the dehydration and the cyclization of the precursor-peptide during lantibiotic synthesis. The C-terminal domain shows similarity to LanC, the cyclase component of the lan operon, but the N terminus seems to be unrelated to the dehydratase, LanB.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AWY98728.1	1.41e-221	1	686	5	751
QNM13425.1	1.64e-215	1	686	1	752
QOS77131.1	8.68e-208	5	686	7	761
AIQ17696.1	4.18e-203	4	686	6	755
ASR48105.1	8.62e-200	4	690	6	759

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6YQH_AAA	1.42e-69	110	635	17	564	ChainAAA, Acetyl-CoA carboxylase, biotin carboxylase [Bacteroides thetaiotaomicron VPI-5482]
5OPJ_A	3.98e-65	110	635	17	564	Beta-L-arabinofuranosidase[Bacteroides thetaiotaomicron]
6EX6_A	7.27e-13	258	688	142	578	TheGH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482],6EX6_B The GH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482]
4QJY_A	1.26e-12	318	629	194	558	Crystalstructure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QJY_B Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
4QK0_A	2.01e-11	318	629	194	558	Crystalstructure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_B Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_C Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_D Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000061	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000206_02495.