CAZyme Information: MGYG000000202_02912

Basic Information

• Species: AF33-28 sp003477885
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; AF33-28; AF33-28 sp003477885
• CAZyme ID: MGYG000000202_02912
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YteR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
361	MGYG000000202_10|CGC3	41113.83	5.4157

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000202	5162288	Isolate	China	Asia

• Gene Location: Start: 94339; End: 95424 Strand: +

Full Sequence      

MKDLHEPIFYAKCSCDTIMRKYEAADLPPKGHFHYHQGVFLSGVYKTWLLSKEDRYFDYI
KDWVDSVTDKEGNILDYAPKHLDDIQPGILLYPLIERTGDVRYRKALDKLISHIDEYPRN
PEGGFWHMDLFADQMWLDGLYMGGPVCAEYGAKYGRPDLLDLVVHQALMMEEKTRDEKTG
LLYHAWDFRRKAEWADPVTGRSPEFWGRSIGWVPVALLDDLDFLPSGHPGRMILSDMTAR
LLEAVCAFQSDEGRWYQVVDKGGKAGNWLENSCSCLFTAALCKAVRNGILSSRYLQYARK
GYEGVIRSLEWEGQDLLVGNVCIGTGVGDYKHYCDRPVSVNDLHGAGAFLLMCEEAQQAI
G

Enzyme Prediction     

No EC number prediction in MGYG000000202_02912.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	28	356	9.4e-103	0.9698795180722891

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4225	YesR	4.46e-112	5	351	6	348	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
pfam07470	Glyco_hydro_88	8.76e-106	10	351	1	334	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCJ92567.1	1.06e-160	10	360	8	359
ATO42094.1	2.97e-158	7	353	6	353
AFU70692.1	2.97e-158	7	353	6	353
QYN59722.1	7.44e-157	7	353	8	355
BCJ93957.1	4.08e-145	7	359	9	363

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1NC5_A	4.98e-109	7	357	13	365	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	2.05e-108	7	357	3	355	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]
4WU0_A	9.01e-73	10	355	4	357	StructuralAnalysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]
3PMM_A	1.28e-20	33	354	66	376	ChainA, Putative cytoplasmic protein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
3K11_A	1.13e-17	135	350	199	404	Crystalstructure of Putative glycosyl hydrolase (NP_813087.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 1.80 A resolution [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O34559	2.73e-108	7	357	13	365	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
P0A3U6	2.31e-29	142	356	1	228	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1
P0A3U7	2.31e-29	142	356	1	228	24.9 kDa protein in picA locus OS=Rhizobium radiobacter OX=358 PE=2 SV=1
P9WF04	1.76e-09	37	355	94	407	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_28 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000062	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000202_02912.