CAZyme Information: MGYG000000202_01716

Basic Information

• Species: AF33-28 sp003477885
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; AF33-28; AF33-28 sp003477885
• CAZyme ID: MGYG000000202_01716
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YteR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
381	MGYG000000202_5|CGC2	45116.77	4.5966

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000202	5162288	Isolate	China	Asia

• Gene Location: Start: 88774; End: 89919 Strand: +

Full Sequence      

MGLQDYFKEYMSRYRGIDAYKDGYEDTQFGQWNYEDGCLLLGVKMMYEVTGDESYRDYAV
RFVKPYVDEDGGIHSYVPGEYNLDFINSGKLFYFLYDVTGEEKYRKAVETLMDQIRHQPR
LTTGNFWHKLIYPFQVWLDGLYMGQPFYLEYENRFNGRKNYYDIVNQFKMVRKYLYDEQT
GLYYHAYDEYKERDWADKETGLSPNFWLRSIGWYLMALVDCYEMASEELYDCKREFCDLY
REAIRGVLRYRDRQSGMFYQLIALPEAEGNYFETSGTLMVAYSILKACRLEILLSDKYLS
VGEEILQAVLDQQLRYDGDTLHLYGTVESAGLGPRHERDGSVAYYLSEPVVTDDPKGQGI
LMMACSEYMRTHDNKEPEKGR

Enzyme Prediction     

No EC number prediction in MGYG000000202_01716.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	25	370	4.3e-101	0.9819277108433735

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4225	YesR	9.74e-85	4	371	13	356	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
pfam07470	Glyco_hydro_88	5.18e-72	31	371	26	342	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCJ93648.1	5.34e-141	3	370	6	363
QHQ62178.1	1.95e-139	17	369	12	363
BCJ96410.1	2.68e-121	4	369	3	362
AVQ19788.1	7.12e-117	6	376	3	373
ADD02984.1	1.13e-116	3	369	8	369

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WU0_A	1.69e-90	27	368	18	358	StructuralAnalysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]
1NC5_A	1.34e-60	31	367	38	363	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	5.65e-60	31	367	28	353	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]
4XUV_A	2.44e-09	32	370	47	370	Crystalstructure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126],4XUV_B Crystal structure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O34559	7.32e-60	31	367	38	363	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
P0A3U6	7.36e-36	143	369	1	229	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1
P0A3U7	7.36e-36	143	369	1	229	24.9 kDa protein in picA locus OS=Rhizobium radiobacter OX=358 PE=2 SV=1
O31521	1.30e-16	32	371	29	338	Unsaturated rhamnogalacturonyl hydrolase YesR OS=Bacillus subtilis (strain 168) OX=224308 GN=yesR PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000045	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000202_01716.