CAZyme Information: MGYG000000201_03399

Basic Information

• Species: Blautia_A sp900066145
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Blautia_A; Blautia_A sp900066145
• CAZyme ID: MGYG000000201_03399
• CAZy Family: GH3
• CAZyme Description: Thermostable beta-glucosidase B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
754	MGYG000000201_16|CGC1	83552.68	4.6262

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000201	4593677	Isolate	China	Asia

• Gene Location: Start: 18015; End: 20279 Strand: +

Full Sequence      

MSRNLKELIREMTLEEKAGLCSGADFWNTMGIERLGIPSAMMTDGPHGLRKQEGAADHLG
LNKSVNAVCFPAACATASSFDVELMERMGQILGDECQAENVSMLLGPAVNIKRSPLCGRN
FEYMSEDPYLTGKMASAYIRGVQSKGIGTSMKHFAVNNQETDRMQISSEVSERAFREIYL
PAFEEAVKKAQPKTVMCSYNKINGVFSSENKKLLTDILRDEWGFEGYVVSDWGAVNDRVK
GLKAGLDLEMPGSEGYNTRKIIRAVENGELEEEILDRTVERILKVVFSYADNRKAETVFD
REKDHKAAADIETECAVLLENKGALPLRKEQKIVYIGEFAKKPRYQGGGSSHINTDSVVS
ALETAVRKGRAVEYVKGFSSERDEMTEEELKQACEAAAGADAVVIFAGLPDSFESEGYDR
TSMELPKCQNRLIEVVAEIQKNVVVVLHNGSPVETPWAESVNAILEMYLGGEGIGEASDR
LLFGEANPGGRLAETFPYRLEDNPSYLNFPGDGRTVLYGEDIFVGYRYYDAKKVPVRWAF
GHGLSYTEFSYSNMKLSSVEMKDGDVLRVSIDVENTGKMAGSEVVQLYVSDKDSTVPRAV
KELKGFAKVFLNPGEKKTVTMELCARDFAYYETKIHDWYTPSGTYEIQIGHASDDIRETA
KLSFTTDVSLPFTVDMTTTMGELMSHPKTAGKMMEYLEGISQGEESKKEEGEVELVTPEI
IAQMPLKSFLSVIPGEAIEQMIVELNSLCAEEGK

Enzyme Prediction     

EC	3.2.1.21	3.2.1.-	3.2.1.45

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	31	251	8.4e-74	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	2.16e-102	7	665	40	763	beta-glucosidase BglX.
COG1472	BglX	2.51e-74	25	360	48	380	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
PLN03080	PLN03080	1.17e-64	1	609	49	728	Probable beta-xylosidase; Provisional
pfam01915	Glyco_hydro_3_C	6.49e-53	316	526	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
pfam00933	Glyco_hydro_3	6.45e-44	34	285	63	316	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBL13846.1	0.0	1	754	1	754
CBL26988.1	0.0	1	749	1	751
CBL13852.1	0.0	5	751	4	750
QHM47964.1	0.0	3	749	5	756
QPK81647.1	0.0	1	697	1	698

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7MS2_A	1.73e-269	1	745	1	747	ChainA, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	4.35e-197	1	687	1	685	CrystalStructure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
3AC0_A	3.25e-141	4	656	5	828	Crystalstructure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	1.62e-137	4	656	5	828	Crystalstructure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
2X40_A	1.11e-134	5	657	4	706	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P14002	1.34e-268	1	745	1	747	Thermostable beta-glucosidase B OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=bglB PE=1 SV=2
F6C6C1	1.47e-193	1	667	1	675	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium breve (strain ACS-071-V-Sch8b) OX=866777 GN=HMPREF9228_1477 PE=1 SV=1
E7CY69	6.59e-192	1	667	1	675	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium longum OX=216816 GN=apy PE=1 SV=1
P27034	6.66e-144	5	667	2	813	Beta-glucosidase OS=Rhizobium radiobacter OX=358 GN=cbg-1 PE=3 SV=1
A7LXS8	6.71e-141	5	664	46	745	Beta-glucosidase BoGH3A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02644 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999962	0.000079	0.000002	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000201_03399.