CAZyme Information: MGYG000000200_02867

Basic Information

• Species: Blautia_A sp003471165
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Blautia_A; Blautia_A sp003471165
• CAZyme ID: MGYG000000200_02867
• CAZy Family: GH151
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
669	MGYG000000200_22|CGC2	77372.01	5.834

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000200	4192583	Isolate	China	Asia

• Gene Location: Start: 19184; End: 21193 Strand: -

Full Sequence      

MAEKEIPFRQIHLDFHTSEAIEGVCSEFDAEEFAQTLADAHVNSITLFSCGHHGNLYYDS
KMFPEMVHPHLAHRDLLREQAEACRKRGIQVNLYTTIRWNKRIADMHPEWICIDENGALQ
DYKGKGYFEAGFYKNLCVNTPYRDFLKKQFGEVLETIPGDGVWYDAAFMNECCCPSCQKL
MREKGLNPAKKEDRQEFARWTYYDMVEDLTAFAKKYNPDFHVCYNKGHVGYLDKPVIKDY
SYFSFESLPGVEWGYLDFPVSAKYMRNFGKECLGLTSRFHTEWGDFHAFRNEAAMEYEVF
SMLSHGCKCTIGDQMDYWGKLNKDMYQQIGRVYKSVEEKEPWCENAKPVSEIGVFTAEEF
YATGVAGQIPGASEGVARLLMEYGYQFDFIDSTSDFGKYRLLILPDVIPVDEILGRKLSA
YINAGGKLLASYQSGLDKDHQKFMISELAVKYLGDAPYSPDFIWPKEHLAKGLADAEHVM
YDKGTLVEATDEAQFVQKVIPPVFNRTYEHFCSHLHSPSGRKEVYPGIVETENTAYFIHP
IFTTYQNWAPAWYKKILRNELDRMLPNPLIQHNGPSTTQVTVLDQEQENRRIVHVLHYVP
VKKCKNLEIVDDIIPLYNLKITMTEEREVEKIYTIPDKQEVPFVQDGKKLEFTLKEIKGH
QMTAVCYKN

Enzyme Prediction     

No EC number prediction in MGYG000000200_02867.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH151	29	165	1.7e-44	0.9847328244274809

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam14871	GHL6	2.85e-30	29	165	1	134	Hypothetical glycosyl hydrolase 6. GHL6 is a family of hypothetical glycoside hydrolases.
cd03143	A4_beta-galactosidase_middle_domain	1.12e-10	378	500	33	149	A4 beta-galactosidase middle domain: a type 1 glutamine amidotransferase (GATase1)-like domain. A4 beta-galactosidase middle domain: a type 1 glutamine amidotransferase (GATase1)-like domain. This group includes proteins similar to beta-galactosidase from Thermus thermophilus. Beta-Galactosidase hydrolyzes the beta-1,4-D-galactosidic linkage of lactose, as well as those of related chromogens, o-nitrophenyl-beta-D-galactopyranoside (ONP-Gal) and 5-bromo-4-chloro-3-indolyl-beta-D-galactoside (X-gal). This A4 beta-galactosidase middle domain lacks the catalytic triad of typical GATase1 domains. The reactive Cys residue found in the sharp turn between a beta strand and an alpha helix termed the nucleophile elbow in typical GATase1 domains is not conserved in this group.
pfam08532	Glyco_hydro_42M	1.38e-07	378	444	37	104	Beta-galactosidase trimerisation domain. This is non catalytic domain B of beta-galactosidase enzymes belong to the glycosyl hydrolase 42 family. This domain is related to glutamine amidotransferase enzymes, but the catalytic residues are replaced by non functional amino acids. This domain is involved in trimerisation.
pfam01120	Alpha_L_fucos	0.001	25	165	81	200	Alpha-L-fucosidase.
smart00812	Alpha_L_fucos	0.002	25	208	78	225	Alpha-L-fucosidase. O-Glycosyl hydrolases (EC 3.2.1.-) are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A classification system for glycosyl hydrolases, based on sequence similarity, has led to the definition of 85 different families. This classification is available on the CAZy (CArbohydrate-Active EnZymes) web site. Because the fold of proteins is better conserved than their sequences, some of the families can be grouped in 'clans'. Family 29 encompasses alpha-L-fucosidases, which is a lysosomal enzyme responsible for hydrolyzing the alpha-1,6-linked fucose joined to the reducing-end N-acetylglucosamine of the carbohydrate moieties of glycoproteins. Deficiency of alpha-L-fucosidase results in the lysosomal storage disease fucosidosis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEE97446.1	2.91e-234	1	665	1	661
BAL99835.1	1.10e-212	6	667	8	681
QUH27692.1	6.18e-195	5	667	3	665
QGQ95137.1	3.50e-191	6	665	5	684
SQI53849.1	3.22e-186	8	665	6	663

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6TVK_AAA	4.75e-122	8	667	32	687	ChainAAA, Alpha-L-fucosidase [Paenibacillus thiaminolyticus]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000049	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000200_02867.