CAZyme Information: MGYG000000199_00312

Basic Information

• Species: Streptococcus parasanguinis_B
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Streptococcaceae; Streptococcus; Streptococcus parasanguinis_B
• CAZyme ID: MGYG000000199_00312
• CAZy Family: GH3
• CAZyme Description: Beta-N-acetylglucosaminidase/beta-glucosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
564	MGYG000000199_1|CGC6	62236.82	4.7149

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000199	2066234	Isolate	China	Asia

• Gene Location: Start: 378441; End: 380135 Strand: -

Full Sequence      

MLNLTQKPYLLTTKQADSIHQLVSEMTTEEKIGQLFFVIGQDEERVSLDDFIDTYKPGGL
MFRPGPAAQISRQIKQIQHHSKYPLFFSANLESGGNGIISEGTWLGNPLQMAATNDPQAA
FELGNIAGYEANQVGCNMSFSPIVDIDLNFKNPITNTRTFGSDPDRVLRMAKAQIQGLEA
NGITPVIKHFPGDGVDERDQHLLSSINSLSAEDWSSSYGQIYKSLIDQGTPCVMIGHIYQ
PAWERKLNPEIKDKDLRPASASKLLIDGLLRTELGFNGLAITDATAMVGYNVILPRKELL
PATINAGIDMILFNKNIDEDYSIVKEAVASGLISIDRLNQAVTRILATKLSQGLMNEVGQ
FIGQIPEKPILKTSEHLEIAAKIAKHSVTLVKDRDQLLPLSPQKTPRVRLVILGDSDEGG
FKEGGKVTDLFKNGLDQLGFEVSLYQMDFHEMFEEGTTDLEEKFDLAFYVANVETASNQT
TTRLNWIQLMAANAPWFAPSIPTVFVSTANPYHLFDVPYISTFINAYTGTPENVAAVLRK
VTGQENFTGINPIDPFCGDFVATL

Enzyme Prediction     

EC	2.4.1.-	3.2.1.21	3.2.1.52

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	79	312	3.4e-47	0.9722222222222222

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1472	BglX	7.55e-66	26	421	1	371	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam00933	Glyco_hydro_3	4.40e-58	27	346	1	314	Glycosyl hydrolase family 3 N terminal domain.
PRK15098	PRK15098	3.01e-32	19	416	38	422	beta-glucosidase BglX.
PRK05337	PRK05337	1.50e-24	116	312	91	278	beta-hexosaminidase; Provisional
PLN03080	PLN03080	7.52e-05	209	428	237	441	Probable beta-xylosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AFJ26726.1	0.0	1	564	1	564
AQP42643.1	0.0	1	564	1	564
SQG79950.1	0.0	1	564	1	564
VTS88627.1	0.0	1	564	1	564
VED92355.1	0.0	1	564	1	564

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5VQD_A	2.35e-149	4	564	6	567	Beta-glucosidephosphorylase BglX [unidentified],5VQE_A Beta-glucoside phosphorylase BglX bound to 2FGlc [unidentified]
3BMX_A	6.60e-44	13	554	29	616	Beta-N-hexosaminidase(YbbD) from Bacillus subtilis [Bacillus subtilis],3BMX_B Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3NVD_A Structure of YBBD in complex with pugnac [Bacillus subtilis],3NVD_B Structure of YBBD in complex with pugnac [Bacillus subtilis]
3LK6_A	2.36e-43	13	554	3	590	ChainA, Lipoprotein ybbD [Bacillus subtilis],3LK6_B Chain B, Lipoprotein ybbD [Bacillus subtilis],3LK6_C Chain C, Lipoprotein ybbD [Bacillus subtilis],3LK6_D Chain D, Lipoprotein ybbD [Bacillus subtilis]
4GYJ_A	3.33e-43	13	554	33	620	Crystalstructure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYJ_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYK_A Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168],4GYK_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168]
6K5J_A	4.92e-42	26	552	11	528	Structureof a glycoside hydrolase family 3 beta-N-acetylglucosaminidase from Paenibacillus sp. str. FPU-7 [Paenibacillaceae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q7WUL3	4.55e-141	1	564	1	564	Beta-N-acetylglucosaminidase/beta-glucosidase OS=Cellulomonas fimi OX=1708 GN=nag3 PE=1 SV=1
P40406	3.61e-43	13	554	29	616	Beta-hexosaminidase OS=Bacillus subtilis (strain 168) OX=224308 GN=nagZ PE=1 SV=1
P48823	8.90e-27	48	400	55	425	Beta-hexosaminidase A OS=Pseudoalteromonas piscicida OX=43662 GN=cht60 PE=1 SV=1
Q56078	1.82e-23	11	405	29	412	Periplasmic beta-glucosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bglX PE=3 SV=2
P33363	1.00e-22	11	405	29	412	Periplasmic beta-glucosidase OS=Escherichia coli (strain K12) OX=83333 GN=bglX PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000081	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000199_00312.