CAZyme Information: MGYG000000198_04408

Basic Information

• Species: Enterocloster citroniae
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Enterocloster; Enterocloster citroniae
• CAZyme ID: MGYG000000198_04408
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YteR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
362	MGYG000000198_9|CGC2	41810.34	4.907

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000198	6476049	Isolate	China	Asia

• Gene Location: Start: 135238; End: 136326 Strand: -

Full Sequence      

MKETATGFETYFRQYLKRGISGGGPWSRWDYKDDLIVKGCYDLFCVTGDSFYRDVIFKIT
EGRLLPDDAPCPYNLDMISGARTDMVFERLTGEDRFHQRFLKKMELFKEYPRTRNGNFWH
KDIYPNQVWLDGLYMAMPVYLQDPVNSEDAMSQYENVRRILFVPEKGLYVHAWDEERRRE
WADPETGLSPNVWLRAMGWYLMSLADCYELVEQKQEERLAELLQEALDHLMKFQDPGTRM
FYQLVDLPGEKGNYPETSGSAMAAYACMKGERLGMLRSGSFEAGAQILKGIGDTWLRNRN
GTWTLGGICESAGLGPGPYNRRDRDGSVKYYLSEPVVEDNQHGVGACMMAWSEWLLGDNP
PH

Enzyme Prediction     

No EC number prediction in MGYG000000198_04408.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	27	355	1.3e-75	0.963855421686747

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4225	YesR	2.82e-61	9	356	13	355	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
pfam07470	Glyco_hydro_88	1.08e-60	24	355	22	340	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQQ99429.1	1.48e-96	11	355	5	363
ANU45824.1	1.48e-96	11	355	5	363
QIX93226.1	4.32e-93	11	355	5	363
AFK85204.1	4.45e-87	29	353	22	356
QTQ12711.1	3.06e-85	9	359	4	361

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WU0_A	1.66e-63	27	354	21	358	StructuralAnalysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]
1NC5_A	1.76e-43	25	353	35	363	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	7.53e-43	25	353	25	353	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]
4XUV_A	5.11e-10	26	291	44	320	Crystalstructure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126],4XUV_B Crystal structure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126]
3K11_A	4.60e-09	108	362	180	418	Crystalstructure of Putative glycosyl hydrolase (NP_813087.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 1.80 A resolution [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O34559	9.62e-43	25	353	35	363	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
P0A3U6	2.64e-35	148	356	20	230	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1
P0A3U7	2.64e-35	148	356	20	230	24.9 kDa protein in picA locus OS=Rhizobium radiobacter OX=358 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000070	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000198_04408.