CAZyme Information: MGYG000000198_01945

Basic Information

• Species: Enterocloster citroniae
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Enterocloster; Enterocloster citroniae
• CAZyme ID: MGYG000000198_01945
• CAZy Family: GH39
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
639	MGYG000000198_3|CGC1	72915.81	4.934

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000198	6476049	Isolate	China	Asia

• Gene Location: Start: 3112; End: 5031 Strand: -

Full Sequence      

MAEFDPDICFCIDHGGKETLLRPFWSATGYANADFTPTPSFLRMYDYLSSFHGHLHYMRL
HNILSLHGEGDRYFLELDLPYGNRCFAHDNRQNGDDKVVARMEDGTLRYNWDLVDQVYDV
IVGHGMAPIVELVYLPKAIRKSEEEFFLPADYRLYGEMVRDFAAHCLERYGLEETRGWYF
EIWNEPDNEAAWCRDPASFFALYDYMEHAVHSVDDRLRTGGPATMQGQEGYRIFEGFLKH
CAGEVNYCTGGYGTRLDFVSVHCKGGQTTDFNPSSAVMFGSVERYLDILEQYPQFCDVEF
FNDESDIIWAGSRGVEDASWFDFRNSHYAPGFVCKMISLYCTRVLDRGVNLTVADSDNAH
LQWERSLFSGNRSQLTPLGRYPCTDMIRKPFFNAYVLLSKLGDRRLPVQCDGPGFNEKFG
VLATRRGPVFSYMLWNFEDGISDMVGKRSFRLNIQNCGVVGSYYLLEYRIDQDHSNSNTL
WHKLGCPKEPNLKQIRQLRDADGLEPMGDPQKITADSGELSLEVTLPQHAVALFQLTPVS
TEAPAAVGFVKAQWEEGCSGRQIFLTWEPSRESDFFHYKVLRSVDGGHYETLSSSPALNT
AVYVDMEVESGHRYSYRILAVNTSGIWGEPGKEAVVRTE

Enzyme Prediction     

No EC number prediction in MGYG000000198_01945.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH39	98	491	1.7e-64	0.8747099767981439

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01229	Glyco_hydro_39	4.31e-42	95	537	59	488	Glycosyl hydrolases family 39.
COG3664	XynB	1.18e-08	107	211	35	135	Beta-xylosidase [Carbohydrate transport and metabolism].
cd00063	FN3	1.62e-06	559	638	13	93	Fibronectin type 3 domain; One of three types of internal repeats found in the plasma protein fibronectin. Its tenth fibronectin type III repeat contains an RGD cell recognition sequence in a flexible loop between 2 strands. Approximately 2% of all animal proteins contain the FN3 repeat; including extracellular and intracellular proteins, membrane spanning cytokine receptors, growth hormone receptors, tyrosine phosphatase receptors, and adhesion molecules. FN3-like domains are also found in bacterial glycosyl hydrolases.
smart00060	FN3	0.002	559	626	13	82	Fibronectin type 3 domain. One of three types of internal repeat within the plasma protein, fibronectin. The tenth fibronectin type III repeat contains a RGD cell recognition sequence in a flexible loop between 2 strands. Type III modules are present in both extracellular and intracellular proteins.
pfam11790	Glyco_hydro_cc	0.009	183	271	70	149	Glycosyl hydrolase catalytic core. This family is probably a glycosyl hydrolase, and is conserved in fungi and some Proteobacteria. The pombe member is annotated as being from IPR013781.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQO10984.1	3.59e-187	12	636	8	637
QYN31969.1	1.40e-69	17	543	39	575
QOR70793.1	5.14e-59	94	538	115	585
CDZ25039.1	2.15e-58	7	536	6	544
ACQ79795.1	2.82e-58	13	539	44	577

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5NDX_A	1.27e-44	21	615	15	603	Thebacterial orthologue of Human a-L-iduronidase does not need N-glycan post-translational modifications to be catalytically competent: Crystallography and QM/MM insights into Mucopolysaccharidosis I [Rhizobium leguminosarum bv. trifolii]
4M29_A	2.45e-31	99	540	71	500	Structureof a GH39 Beta-xylosidase from Caulobacter crescentus [Caulobacter vibrioides CB15]
4EKJ_A	4.46e-31	99	540	71	500	ChainA, Beta-xylosidase [Caulobacter vibrioides]
6YYH_A	4.56e-30	109	548	100	514	Crystalstructure of beta-D-xylosidase from Dictyoglomus thermophilum in ligand-free form [Dictyoglomus thermophilum H-6-12],6YYH_B Crystal structure of beta-D-xylosidase from Dictyoglomus thermophilum in ligand-free form [Dictyoglomus thermophilum H-6-12],6YYI_A Crystal structure of beta-D-xylosidase from Dictyoglomus thermophilum bound to beta-D-xylopyranose [Dictyoglomus thermophilum H-6-12],6YYI_B Crystal structure of beta-D-xylosidase from Dictyoglomus thermophilum bound to beta-D-xylopyranose [Dictyoglomus thermophilum H-6-12]
1PX8_A	5.19e-29	109	548	77	491	Crystalstructure of beta-D-xylosidase from Thermoanaerobacterium saccharolyticum, a family 39 glycoside hydrolase [Thermoanaerobacterium saccharolyticum],1PX8_B Crystal structure of beta-D-xylosidase from Thermoanaerobacterium saccharolyticum, a family 39 glycoside hydrolase [Thermoanaerobacterium saccharolyticum],1UHV_A Crystal structure of beta-D-xylosidase from Thermoanaerobacterium saccharolyticum, a family 39 glycoside hydrolase [Thermoanaerobacterium saccharolyticum],1UHV_B Crystal structure of beta-D-xylosidase from Thermoanaerobacterium saccharolyticum, a family 39 glycoside hydrolase [Thermoanaerobacterium saccharolyticum],1UHV_C Crystal structure of beta-D-xylosidase from Thermoanaerobacterium saccharolyticum, a family 39 glycoside hydrolase [Thermoanaerobacterium saccharolyticum],1UHV_D Crystal structure of beta-D-xylosidase from Thermoanaerobacterium saccharolyticum, a family 39 glycoside hydrolase [Thermoanaerobacterium saccharolyticum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q01634	7.72e-31	21	631	42	629	Alpha-L-iduronidase OS=Canis lupus familiaris OX=9615 GN=IDUA PE=1 SV=1
O30360	6.46e-29	109	548	77	491	Beta-xylosidase OS=Thermoanaerobacterium saccharolyticum (strain DSM 8691 / JW/SL-YS485) OX=1094508 GN=xynB PE=3 SV=1
P48441	9.63e-29	96	631	85	620	Alpha-L-iduronidase OS=Mus musculus OX=10090 GN=Idua PE=1 SV=2
P36906	2.11e-28	109	548	77	491	Beta-xylosidase OS=Thermoanaerobacterium saccharolyticum OX=28896 GN=xynB PE=1 SV=1
P23552	2.51e-28	93	531	64	480	Beta-xylosidase OS=Caldicellulosiruptor saccharolyticus OX=44001 GN=xynB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000036	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000198_01945.