CAZyme Information: MGYG000000198_01776

Basic Information

• Species: Enterocloster citroniae
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Enterocloster; Enterocloster citroniae
• CAZyme ID: MGYG000000198_01776
• CAZy Family: GH127
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
629	MGYG000000198_2|CGC7	72709.7	5.2796

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000198	6476049	Isolate	China	Asia

• Gene Location: Start: 645312; End: 647201 Strand: -

Full Sequence      

MCTKNIKRLKCCRIPEIRPEGWLKRQMEIQMEGLTGKLYQVWDCVGSYSGWLGGTGENWE
RGPYYLDGLLPLAWYLKDEEHWELACRFVEWTLESADASGNFGPVASRQDYWSRFVMLKV
LIQYYEIKEDERVLKLFSGYFSYLQEEILKRPMTQWSKARIGDLLYCINWYCQQTGEVLK
ELAAELKSQALDWNEVFEDFPFVRPAEYYYSWDRLLAHYQKSSMDEVMKYHTNHIVNLTM
GFKYPAMLSYFFDDRDYEEITDRGLEAAEHFHGVATGALNGDEHLAGNNPSRGAELCSVV
EYMFSLQTMIEAFGRGDYGDKIEKLAYNALPATITEDFMAHQYLQQANQVLANRAERDWF
NTNEESNMFGLEPNFGCCTANMHQGWPKLLKSLWFKENEHTLVSMVHAPSSIVTQLAGEK
VHIIEETEYPFKNRICYRVAEGEAPEAVLRIWIPGWCSHIRVGQEGKQRRLGRSEDYVTV
RGLKAGDEITVEFEMDIRQSHWFKDSLAVERGPLVYALNIKEQWKAVRKVAGVSDYEVYP
ISPWNYAISKNAPLAVAENTIGRVPFSKQNPPVVLTGTGKRLEGWCLEHNSAGLIPKSPV
EIQGEPEKIELIPYGCTKLRITQFPYYVE

Enzyme Prediction     

No EC number prediction in MGYG000000198_01776.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH127	294	517	8e-26	0.4255725190839695

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07944	Glyco_hydro_127	1.70e-20	257	517	239	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
COG3533	COG3533	1.14e-11	257	518	241	502	Uncharacterized conserved protein, DUF1680 family [Function unknown].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QJE95537.1	1.91e-119	17	625	48	646
ATP55412.1	1.41e-114	17	625	48	649
ALL07583.1	3.80e-114	17	625	48	649
AOM80627.1	1.79e-113	17	625	42	643
QHS59113.1	3.87e-113	17	625	48	649

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4QJY_A	2.26e-11	289	518	327	561	Crystalstructure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QJY_B Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
4QK0_A	1.89e-09	289	518	327	561	Crystalstructure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_B Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_C Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_D Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000025	0.000016	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000198_01776.