CAZyme Information: MGYG000000196_04393

Basic Information

• Species: Bacteroides thetaiotaomicron
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides thetaiotaomicron
• CAZyme ID: MGYG000000196_04393
• CAZy Family: GH2
• CAZyme Description: Beta-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1085	MGYG000000196_26|CGC2	123506.57	6.7472

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000196	6397474	Isolate	China	Asia

• Gene Location: Start: 44736; End: 47993 Strand: -

Full Sequence      

MNMKRSLILLCGLLTGFTLQSTKVNAQTQTVANDQKLVYPYTFAPSEGLVNQTEKEHRQE
ICINGYWDFQPVRLPKEYVQGKGIAPELPLPENDSEWSKTRIKIPSPWNINAFAYRDLEG
PDHRNYPSYPKEWEQVKMAWMKKNVTIPADWSGQQIKLHFEAVAGYSEVYVNKEKVGENF
DLFLPFSFDITDKVTAGENIEILVGVRSQSLFENNATIGRRIVPGGSMWGYQINGIWQDV
YLLALPKIHLEDVYVKPLVSKNTLEIEVTLQNRTEKKTDVQLQGNICEWVNCAGTDVNSA
PVPNWTLGNEALKVAPTKLSLPAKASQKVTLQVPVDKDILKYWTPEHPNLYALLLSVNNQ
KQTVDTKYERFGWREWTLQGTTQYLNGEPYALHGDSWHFMGIPQMTRRYAWAWFTAIKGM
NANAVRPHAQVYPRFYLDMADEMGICVLNETANWASDGGPKLDSDLFWEASKEHLKRFVL
RDRNHASVFGWSISNENKPVILHVYNRPELMPVQKKAWEEWRDIVHQYDPTRPWISADGE
DDGDGILPVTVGHYGDINSMKRWIEIGKPWGIGEHSMAYYGTPEQVAKYNGERAYESQEG
RMEGLANECYNLIVNQRQMGASYSTVFNMAWYALKPLPLGKKDKSKAPTVEADGVFFGDY
KEGVPGVQPERVGPYCTTFNPGYDPTLPLYQEWPMYSALRAANAPGQPAWSPYAVIDKQQ
YDHRKTTTPSKKYKEVIFIGSQNSKLKQLMDAQGVIFAKKANTPSLLLYIVDGSQKLDAS
TKDEMQKQIAKGADVWIWGLTPETVAAYNEILPLPVSLDNLQRSSFLPVQKSWMHGLNNS
DFYFCELQKTNASSYSLKGAFVEEGEVLLNACKTDWRKWNKRPEEIKTAGTIRSEYECTA
ATPVFVKCQQNASTFYLNTLTEFANSEKGFNTLSAILKNAGIAFQKPEVNIDEVFFLRDE
QINFPVATKEKLVKDSDGEWTLELYVFSPRPLDDLLIEPNMPKLSLFVKAKKRALLINDK
PYTAVSHDGRNEIIYKELPLLQGWNKLVIKLGAGDRNDFTGYFKCDNKKDFLPLLKAAFV
NPETK

Enzyme Prediction     

No EC number prediction in MGYG000000196_04393.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	50	700	5.2e-88	0.6263297872340425

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	1.87e-37	58	505	10	415	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
PRK10340	ebgA	1.34e-33	39	496	20	449	cryptic beta-D-galactosidase subunit alpha; Reviewed
PRK10150	PRK10150	7.17e-30	53	533	5	444	beta-D-glucuronidase; Provisional
PRK09525	lacZ	1.03e-18	64	496	56	462	beta-galactosidase.
pfam02837	Glyco_hydro_2_N	8.33e-18	63	246	4	169	Glycosyl hydrolases family 2, sugar binding domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities and has a jelly-roll fold. The domain binds the sugar moiety during the sugar-hydrolysis reaction.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMW88731.1	0.0	1	1085	1	1085
ALJ40815.1	0.0	1	1085	1	1085
AAO76875.1	0.0	1	1085	1	1085
QQA09904.1	0.0	3	1085	1	1083
QUT39621.1	0.0	1	1085	1	1085

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6SD0_A	1.36e-32	54	496	32	441	Structureof beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_B Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_C Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_D Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8]
6S6Z_A	1.36e-32	54	496	31	440	Structureof beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_B Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_C Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_D Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_E Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_F Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_G Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_H Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8]
3GM8_A	2.50e-26	93	546	30	432	ChainA, Glycoside hydrolase family 2, candidate beta-glycosidase [Phocaeicola vulgatus ATCC 8482]
5T98_A	2.15e-24	93	533	50	446	Crystalstructure of BuGH2Awt [Bacteroides uniformis],5T98_B Crystal structure of BuGH2Awt [Bacteroides uniformis],5T99_A Crystal structure of BuGH2Awt in complex with Galactoisofagomine [Bacteroides uniformis],5T99_B Crystal structure of BuGH2Awt in complex with Galactoisofagomine [Bacteroides uniformis]
5C70_A	5.52e-22	93	533	37	449	Thestructure of Aspergillus oryzae beta-glucuronidase [Aspergillus oryzae],5C70_B The structure of Aspergillus oryzae beta-glucuronidase [Aspergillus oryzae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q56307	7.45e-32	54	496	32	441	Beta-galactosidase OS=Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) OX=243274 GN=lacZ PE=1 SV=2
P77989	5.96e-28	129	533	48	411	Beta-galactosidase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) OX=340099 GN=lacZ PE=3 SV=2
T2KPJ7	3.60e-26	87	532	69	464	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21970 PE=2 SV=1
Q7MG04	2.50e-25	57	566	44	522	Beta-galactosidase OS=Vibrio vulnificus (strain YJ016) OX=196600 GN=lacZ PE=3 SV=1
Q8D4H3	5.69e-25	57	566	44	523	Beta-galactosidase OS=Vibrio vulnificus (strain CMCP6) OX=216895 GN=lacZ PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000263	0.999048	0.000197	0.000175	0.000157	0.000139

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000196_04393.