CAZyme Information: MGYG000000196_01824

Basic Information

• Species: Bacteroides thetaiotaomicron
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides thetaiotaomicron
• CAZyme ID: MGYG000000196_01824
• CAZy Family: GH18
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
347		39963.32	6.3934

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000196	6397474	Isolate	China	Asia

• Gene Location: Start: 66869; End: 67912 Strand: +

Full Sequence      

MKHVLYALLTAVSILFTSCGPSSNTNNPQVPNVPQPQPQPQPEVTQKVVIGYLALDDWEF
ESLFPTIEWKYLTHINASFARVKADGTLNINPVRKRIESVRETAHKHNVKILISLAKNSP
GEFTTAINDPKARKELIQQIIAFTKEYKLDGFDIDYEEYDNWDKNFPSLLVFARGLYLAK
EKNMLMTCAVNSRWLNYGTEWEQYFDYINLMSYDRGAFTDKPVQHASYDDFVKDLKYWNE
QCRASKSKIVGGLPFYGYSWEESLQGAVDDVRGIRYSGILKHLGNEAADKDNIGKTYYNG
RPTIANKCKFIKENDYAGVMIWQLFQDAHNDNYDLKLINVVGREMME

Enzyme Prediction     

No EC number prediction in MGYG000000196_01824.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	46	334	2.2e-47	0.9628378378378378

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06545	GH18_3CO4_chitinase	4.42e-131	49	338	1	253	The Bacteroides thetaiotaomicron protein represented by pdb structure 3CO4 is an uncharacterized bacterial member of the family 18 glycosyl hydrolases with homologs found in Flavobacterium, Stigmatella, and Pseudomonas.
pfam00704	Glyco_hydro_18	5.19e-39	48	327	1	307	Glycosyl hydrolases family 18.
smart00636	Glyco_18	9.35e-38	48	327	1	334	Glyco_18 domain.
cd00598	GH18_chitinase-like	1.94e-35	49	327	1	210	The GH18 (glycosyl hydrolase, family 18) type II chitinases hydrolyze chitin, an abundant polymer of beta-1,4-linked N-acetylglucosamine (GlcNAc) which is a major component of the cell wall of fungi and the exoskeleton of arthropods. Chitinases have been identified in viruses, bacteria, fungi, protozoan parasites, insects, and plants. The structure of the GH18 domain is an eight-stranded beta/alpha barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel. The GH18 family includes chitotriosidase, chitobiase, hevamine, zymocin-alpha, narbonin, SI-CLP (stabilin-1 interacting chitinase-like protein), IDGF (imaginal disc growth factor), CFLE (cortical fragment-lytic enzyme) spore hydrolase, the type III and type V plant chitinases, the endo-beta-N-acetylglucosaminidases, and the chitolectins. The GH85 (glycosyl hydrolase, family 85) ENGases (endo-beta-N-acetylglucosaminidases) are closely related to the GH18 chitinases and are included in this alignment model.
cd02872	GH18_chitolectin_chitotriosidase	4.88e-22	73	324	29	338	This conserved domain family includes a large number of catalytically inactive chitinase-like lectins (chitolectins) including YKL-39, YKL-40 (HCGP39), YM1, oviductin, and AMCase (acidic mammalian chitinase), as well as catalytically active chitotriosidases. The conserved domain is an eight-stranded alpha/beta barrel fold belonging to the family 18 glycosyl hydrolases. The fold has a pronounced active-site cleft at the C-terminal end of the beta-barrel. The chitolectins lack a key active site glutamate (the proton donor required for hydrolytic activity) but retain highly conserved residues involved in oligosaccharide binding. Chitotriosidase is a chitinolytic enzyme expressed in maturing macrophages, which suggests that it plays a part in antimicrobial defense. Chitotriosidase hydrolyzes chitotriose, as well as colloidal chitin to yield chitobiose and is therefore considered an exochitinase. Chitotriosidase occurs in two major forms, the large form being converted to the small form by either RNA or post-translational processing. Although the small form, containing the chitinase domain alone, is sufficient for the chitinolytic activity, the additional C-terminal chitin-binding domain of the large form plays a role in processing colloidal chitin. The chitotriosidase gene is nonessential in humans, as about 35% of the population are heterozygous and 6% homozygous for an inactivated form of the gene. HCGP39 is a 39-kDa human cartilage glycoprotein thought to play a role in connective tissue remodeling and defense against pathogens.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AAO77931.1	1.98e-260	1	347	1	347
QMW85261.1	1.98e-260	1	347	1	347
QUT72969.1	1.98e-260	1	347	1	347
QQA09007.1	1.34e-258	1	347	1	347
BCA52162.1	1.10e-257	1	347	1	347

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3CO4_A	4.52e-227	47	347	4	304	Crystalstructure of a chitinase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],3FND_A Crystal structure of a chitinase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron]
6XYZ_A	1.36e-39	49	339	19	302	Crystalstructure of the GH18 chitinase ChiB from the chitin utilization locus of Flavobacterium johnsoniae [Flavobacterium johnsoniae UW101]
6KXN_A	5.14e-14	47	346	8	371	Crystalstructure of W50A mutant of Chitiniphilus shinanonensis chitinase ChiL (CsChiL) complexed with N,N'-diacetylchitobiose [Chitiniphilus shinanonensis],6KXN_B Crystal structure of W50A mutant of Chitiniphilus shinanonensis chitinase ChiL (CsChiL) complexed with N,N'-diacetylchitobiose [Chitiniphilus shinanonensis]
6KST_A	6.91e-14	62	346	22	371	Crystalstructure of the catalytic domain of chitinase ChiL from Chitiniphilus shinanonensis (CsChiL) [Chitiniphilus shinanonensis],6KST_B Crystal structure of the catalytic domain of chitinase ChiL from Chitiniphilus shinanonensis (CsChiL) [Chitiniphilus shinanonensis],6KXL_A Crystal structure of the catalytic domain of Chitiniphilus shinanonensis chitinase ChiL (CsChiL) complexed with N,N'-diacetylchitobiose [Chitiniphilus shinanonensis],6KXL_B Crystal structure of the catalytic domain of Chitiniphilus shinanonensis chitinase ChiL (CsChiL) complexed with N,N'-diacetylchitobiose [Chitiniphilus shinanonensis]
6INX_A	2.62e-13	68	323	23	325	Structuralinsights into a novel glycoside hydrolase family 18 N-acetylglucosaminidase from Paenibacillus barengoltzii [Paenibacillus barengoltzii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9W5U2	2.94e-12	67	327	1433	1753	Probable chitinase 10 OS=Drosophila melanogaster OX=7227 GN=Cht10 PE=2 SV=2
Q9W092	1.81e-10	104	335	114	397	Probable chitinase 2 OS=Drosophila melanogaster OX=7227 GN=Cht2 PE=1 SV=1
P29030	1.39e-08	97	324	88	364	Endochitinase OS=Brugia malayi OX=6279 PE=1 SV=1
Q9BZP6	2.38e-08	123	327	106	365	Acidic mammalian chitinase OS=Homo sapiens OX=9606 GN=CHIA PE=1 SV=1
Q11174	3.67e-08	73	345	83	423	Probable endochitinase OS=Caenorhabditis elegans OX=6239 GN=cht-1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000037	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000196_01824.