CAZyme Information: MGYG000000196_00338

Basic Information

• Species: Bacteroides thetaiotaomicron
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides thetaiotaomicron
• CAZyme ID: MGYG000000196_00338
• CAZy Family: GH115
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
982	MGYG000000196_1|CGC7	111402.78	6.9862

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000196	6397474	Isolate	China	Asia

• Gene Location: Start: 446350; End: 449298 Strand: -

Full Sequence      

MRILFLLVVLSVTSALQSQVVIKENAIQSKYAFPLVTSKAKAVVVYDTDDYLVVRKTAEL
FVSDVESVTGQQLRLTDKLKGDKEIIIVGTVEKNRLIRQLAEKGKLDISSLEGTWERFLI
QTVSRPFPGVSKALVVAGSDRRGAAYGLFSLSEMMGVSPWYWWADVPVKKHKTLYVDAPA
TLSKTPSVKYRGIFLNDEDWGLKPWAAKTFEKERGNIGPRTYAKICELLLRLKANHLAPA
MHPVSTAFYKIPENKLVADTFAIVMGSSHCEPLLLNTASEWDSKTMGPWDYNKNKDKINE
VLSNRVKENCAYENVYTLALRGLHDAAMGGGDVPMREKVKMLESALNAQREIIARHIDKP
VETIPQAFTPYKEVLEIYSNGLELPDDVTIIWADDNFGYMKRLSGPQEQKRSGRAGVYYH
ISYLGVPHSYLWYSTTPPALMYEELRKAYDTTADRVWLANCGDLKGAETQISLFLDMAYD
IDSFNADNVATYPARWLAKMFGEEYYDTLEDITCSHINLAFSRKPEYMGWGYWNNYWGGG
EKRTDTEFSFANYNEAERRLTEYSRIGKKTEDLLASLDEKSKPAFYQLLYYPVKGAELMN
HMTIKGQFYRQYVRQQRAAANRLKAQVKCYHDSLEIITDGYNSLLDGKWKHMMSLKQNYD
GTSSYFMIPLMEEEYTPVGFPKLGLQAESENLDKGGMSFHTLPAYSTYSRKSHWIDIYNQ
GTGELSWSITPSEDWILISQKSGKTSAENRIYISVDWDKVPAGEKVKGQIDITSGTQKET
VLVSVFNPESPARTEVQGLYVEENGYISIPAADFHRKFESNDIRMSILPGLGFEGRSLQL
GNPTAPLQMYRAGDVPRVEYDFYTFNAGIYDVYTYVLPTFPLHAERDYKLPEHTNSDTKY
SVRIDDGSISTPSTSAIEYSQIWYDSVLKNCRVNKSTLYVKKPGKHTLQIRCGDPGVVIQ
KIVIDLGGMKRSYLGPQSTICN

Enzyme Prediction     

No EC number prediction in MGYG000000196_00338.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH115	32	661	2.9e-229	0.8292682926829268

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam15979	Glyco_hydro_115	3.12e-168	184	526	1	333	Glycosyl hydrolase family 115. Glyco_hydro_115 is a family of glycoside hydrolases likely to have the activity of xylan a-1,2-glucuronidase, EC:3.2.1.131, or a-(4-O-methyl)-glucuronidase EC:3.2.1.-.
pfam17829	GH115_C	7.55e-58	800	976	2	170	Gylcosyl hydrolase family 115 C-terminal domain. This domain is found at the C-terminus of glycosyl hydrolase family 115 proteins. This domain has a beta-sandwich fold.
pfam03648	Glyco_hydro_67N	2.68e-05	65	151	44	120	Glycosyl hydrolase family 67 N-terminus. Alpha-glucuronidases, components of an ensemble of enzymes central to the recycling of photosynthetic biomass, remove the alpha-1,2 linked 4-O-methyl glucuronic acid from xylans. This family represents the N-terminal region of alpha-glucuronidase. The N-terminal domain forms a two-layer sandwich, each layer being formed by a beta sheet of five strands. A further two helices form part of the interface with the central, catalytic, module (pfam07488).
cd14948	BACON	3.40e-05	726	784	27	81	Bacteroidetes-Associated Carbohydrate-binding (putative) Often N-terminal (BACON) domain. The BACON domain is found in diverse domain architectures and accociated with a wide variety of domains, including carbohydrate-active enzymes and proteases. It was named for its suggested function of carbohydrate binding; the latter was inferred from domain architectures, sequence conservation, and phyletic distribution. However, recent experimental data suggest that its primary function in Bacteroides ovatus endo-xyloglucanase BoGH5A is to distance the catalytic module from the cell surface and confer additional mobility to the catalytic domain for attack of the polysaccharide. No evidence for a direct role in carbohydrate binding could be found in that case. The large majority of BACON domains are found in Bacteroidetes.
pfam19190	BACON_2	1.18e-04	719	785	24	88	Viral BACON domain. This family represents a distinct class of BACON domains found in crAss-like phages, the most common viral family in the human gut, in which they are found in tail fiber genes. This suggests they may play a role in phage-host interactions.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMW85894.1	0.0	1	982	1	982
AAO78620.1	0.0	1	982	1	982
QQA08355.1	0.0	1	982	1	982
ALJ44299.1	0.0	1	982	1	982
QUT41413.1	0.0	1	982	1	982

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4ZMH_A	2.34e-150	47	976	28	930	Crystalstructure of a five-domain GH115 alpha-Glucuronidase from the Marine Bacterium Saccharophagus degradans 2-40T [Saccharophagus degradans 2-40],4ZMH_B Crystal structure of a five-domain GH115 alpha-Glucuronidase from the Marine Bacterium Saccharophagus degradans 2-40T [Saccharophagus degradans 2-40]
5BY3_A	1.62e-126	53	656	39	618	Anovel family GH115 4-O-Methyl-alpha-glucuronidase, BtGH115A, with specificity for decorated arabinogalactans [Bacteroides thetaiotaomicron VPI-5482]
6NPS_A	1.72e-108	35	979	12	963	Crystalstructure of GH115 enzyme AxyAgu115A from Amphibacillus xylanus [Amphibacillus xylanus NBRC 15112],6NPS_B Crystal structure of GH115 enzyme AxyAgu115A from Amphibacillus xylanus [Amphibacillus xylanus NBRC 15112]
4C90_A	1.15e-107	33	974	44	844	Evidencethat GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C90_B Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C91_A Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C91_B Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus]
7PUG_A	8.04e-98	79	657	62	629	ChainA, xylan alpha-1,2-glucuronidase [uncultured bacterium]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000263	0.999163	0.000161	0.000141	0.000135	0.000132

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000196_00338.