CAZyme Information: MGYG000000193_01672

Basic Information

• Species: KLE1615 sp900066985
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; KLE1615; KLE1615 sp900066985
• CAZyme ID: MGYG000000193_01672
• CAZy Family: CE8
• CAZyme Description: Pectinesterase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
309	MGYG000000193_14|CGC2	34034.12	5.3837

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000193	4116467	Isolate	China	Asia

• Gene Location: Start: 62710; End: 63639 Strand: -

Full Sequence      

MITIKAGQSTSFPRIADAIEAAKAYAPMPVTIHIAPGRYHEKLTISQPHVTLMGDDASNT
ILTYDDYAREIMPDGIKRGTFRTYTLFLDAPDITLCNLTVENAAGAGKEVGQAIALYAEG
EGIRVENCRLIGSQDTLFTGPLPEKEKEPGGFRGPKEFAPRINGRQYYKNTYICGGVDFI
FGSATAYFENCTLESLPEGGGYVTAGSSPKGQTYGYIFNHCRFIGSEPNTCYLGRPWREY
AKVVILNSEIGDHIKPEGWHDWGKIDAHDTVYFAEYKNYGPGAAGARPSWTHTLTDTEAE
NYTYASVFN

Enzyme Prediction     

No EC number prediction in MGYG000000193_01672.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	3	308	1e-91	0.9826388888888888

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4677	PemB	9.50e-64	1	308	83	402	Pectin methylesterase and related acyl-CoA thioesterases [Carbohydrate transport and metabolism, Lipid transport and metabolism].
pfam01095	Pectinesterase	2.64e-62	9	306	9	293	Pectinesterase.
PLN02432	PLN02432	6.29e-57	2	299	11	277	putative pectinesterase
PLN02682	PLN02682	4.18e-56	12	299	82	352	pectinesterase family protein
PLN02773	PLN02773	3.72e-50	1	302	6	290	pectinesterase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBL11054.1	2.53e-118	12	288	14	335
VCV23720.1	2.53e-118	12	288	14	335
CBL08524.1	2.53e-118	12	288	14	335
BCJ93650.1	3.02e-116	12	303	18	313
SET76962.1	1.31e-114	1	309	1	314

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1XG2_A	1.12e-33	12	296	15	285	ChainA, Pectinesterase 1 [Solanum lycopersicum]
1GQ8_A	4.45e-33	2	306	9	300	Pectinmethylesterase from Carrot [Daucus carota]
2NSP_A	3.72e-30	1	307	7	333	ChainA, Pectinesterase A [Dickeya dadantii 3937],2NSP_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NST_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NST_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT6_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT6_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT9_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT9_B Chain B, Pectinesterase A [Dickeya dadantii 3937]
5C1E_A	2.39e-27	7	283	14	266	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]
5C1C_A	4.62e-27	7	283	14	266	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9LVQ0	1.12e-40	1	306	6	294	Pectinesterase 31 OS=Arabidopsis thaliana OX=3702 GN=PME31 PE=1 SV=1
Q9SIJ9	9.49e-40	32	299	83	317	Putative pectinesterase 11 OS=Arabidopsis thaliana OX=3702 GN=PME11 PE=3 SV=1
Q8VYZ3	6.86e-39	5	302	89	369	Probable pectinesterase 53 OS=Arabidopsis thaliana OX=3702 GN=PME53 PE=2 SV=1
Q5MFV6	1.31e-38	9	306	284	569	Probable pectinesterase/pectinesterase inhibitor VGDH2 OS=Arabidopsis thaliana OX=3702 GN=VGDH2 PE=2 SV=2
Q9FM79	3.44e-38	30	302	110	366	Pectinesterase QRT1 OS=Arabidopsis thaliana OX=3702 GN=QRT1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000061	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000193_01672.