CAZyme Information: MGYG000000179_01027

Basic Information

• Species: Enterocloster aldenensis
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Enterocloster; Enterocloster aldenensis
• CAZyme ID: MGYG000000179_01027
• CAZy Family: GT8
• CAZyme Description: General stress protein A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
333	MGYG000000179_1|CGC13	39190.1	8.5742

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000179	6044848	Isolate	China	Asia

• Gene Location: Start: 1123035; End: 1124036 Strand: -

Full Sequence      

MEWNEETANIIYASNDGYAGHLAASMYSLLDNNRNIRNMDLYVLSAQMCQEYKDRLVDMA
GAFHRTLYVVELGDLRQRFDFEIDTRGFDISAMGRLFAPQVLPGTVKKALYLDCDTIVCQ
SIRPLYETGLGDALVGMVMEPTVYREMKESIGLGKDDPYYNSGVLLMDLDRWRGEDVLKK
LLDFYKSCHGRLFACDQDTINGALKGRIKTLPVKYNYFTNYRYFRYSTLCTMCAAYREIG
EEAYLEARRSPAIIHYLGDERPWIAGNHNHFKKLYEYYLARTPWKDTPRQTGKERYMHMW
WLFNRLTWLCPPFRLWVSRHMGMKLVDSRRKRK

Enzyme Prediction     

No EC number prediction in MGYG000000179_01027.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT8	5	263	4.3e-47	0.8793774319066148

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04194	GT8_A4GalT_like	2.14e-75	9	263	2	246	A4GalT_like proteins catalyze the addition of galactose or glucose residues to the lipooligosaccharide (LOS) or lipopolysaccharide (LPS) of the bacterial cell surface. The members of this family of glycosyltransferases catalyze the addition of galactose or glucose residues to the lipooligosaccharide (LOS) or lipopolysaccharide (LPS) of the bacterial cell surface. The enzymes exhibit broad substrate specificities. The known functions found in this family include: Alpha-1,4-galactosyltransferase, LOS-alpha-1,3-D-galactosyltransferase, UDP-glucose:(galactosyl) LPS alpha1,2-glucosyltransferase, UDP-galactose: (glucosyl) LPS alpha1,2-galactosyltransferase, and UDP-glucose:(glucosyl) LPS alpha1,2-glucosyltransferase. Alpha-1,4-galactosyltransferase from N. meningitidis adds an alpha-galactose from UDP-Gal (the donor) to a terminal lactose (the acceptor) of the LOS structure of outer membrane. LOSs are virulence factors that enable the organism to evade the immune system of host cells. In E. coli, the three alpha-1,2-glycosyltransferases, that are involved in the synthesis of the outer core region of the LPS, are all members of this family. The three enzymes share 40 % of sequence identity, but have different sugar donor or acceptor specificities, representing the structural diversity of LPS.
COG1442	RfaJ	2.53e-39	6	288	1	270	Lipopolysaccharide biosynthesis protein, LPS:glycosyltransferase [Cell wall/membrane/envelope biogenesis].
pfam01501	Glyco_transf_8	1.67e-32	9	263	1	248	Glycosyl transferase family 8. This family includes enzymes that transfer sugar residues to donor molecules. Members of this family are involved in lipopolysaccharide biosynthesis and glycogen synthesis. This family includes Lipopolysaccharide galactosyltransferase, lipopolysaccharide glucosyltransferase 1, and glycogenin glucosyltransferase.
cd00505	Glyco_transf_8	1.21e-25	10	263	4	244	Members of glycosyltransferase family 8 (GT-8) are involved in lipopolysaccharide biosynthesis and glycogen synthesis. Members of this family are involved in lipopolysaccharide biosynthesis and glycogen synthesis. GT-8 comprises enzymes with a number of known activities: lipopolysaccharide galactosyltransferase, lipopolysaccharide glucosyltransferase 1, glycogenin glucosyltransferase, and N-acetylglucosaminyltransferase. GT-8 enzymes contains a conserved DXD motif which is essential in the coordination of a catalytic divalent cation, most commonly Mn2+.
PRK15171	PRK15171	2.61e-11	9	288	27	295	lipopolysaccharide 3-alpha-galactosyltransferase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIX92492.1	2.84e-188	1	333	1	333
QQQ98689.1	4.03e-188	1	333	1	333
ANU46595.1	4.03e-188	1	333	1	333
ASN93815.1	1.64e-187	1	333	1	333
QRP41521.1	1.64e-187	1	333	1	333

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3TZT_A	6.71e-19	37	282	34	271	Thestructure of a protein in glycosyl transferase family 8 from Anaerococcus prevotii. [Anaerococcus prevotii DSM 20548],3TZT_B The structure of a protein in glycosyl transferase family 8 from Anaerococcus prevotii. [Anaerococcus prevotii DSM 20548]
1SS9_A	7.97e-19	9	263	2	252	ChainA, alpha-1,4-galactosyl transferase [Neisseria meningitidis]
1G9R_A	1.81e-17	9	263	2	252	ChainA, GLYCOSYL TRANSFERASE [Neisseria meningitidis],1GA8_A Chain A, GALACTOSYL TRANSFERASE LGTC [Neisseria meningitidis]
6U4B_A	9.18e-16	10	285	304	589	ChainA, WbbM protein [Klebsiella pneumoniae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P25148	4.33e-30	5	284	4	276	General stress protein A OS=Bacillus subtilis (strain 168) OX=224308 GN=gspA PE=1 SV=2
P27129	5.05e-23	6	299	26	314	Lipopolysaccharide 1,2-glucosyltransferase OS=Escherichia coli (strain K12) OX=83333 GN=rfaJ PE=3 SV=2
P43974	1.27e-19	6	217	37	246	Putative glycosyltransferase HI_0258 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=HI_0258 PE=3 SV=2
A0A0H2URH7	4.04e-15	1	308	297	546	Glycosyltransferase GlyA OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=glyA PE=3 SV=1
Q9AEU2	7.77e-13	107	292	106	266	Probable glycosyl transferase Gly OS=Streptococcus gordonii OX=1302 GN=gly PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000035	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000179_01027.