CAZyme Information: MGYG000000176_01981

Basic Information

• Species: Muricomes oroticus
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Muricomes; Muricomes oroticus
• CAZyme ID: MGYG000000176_01981
• CAZy Family: GH93
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
698	MGYG000000176_7|CGC1	76024.78	4.2105

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000176	5921397	Isolate	China	Asia

• Gene Location: Start: 82650; End: 84746 Strand: +

Full Sequence      

MRKWHKKLTALVAVFTLVFCFSVPASAQTTDNGTVVYVSDKDATFDPGGATYSRIICLKN
SGNANGTLLCTYDQLKNVTIAMEDGTSVSKQVYPIYKSTDNGDNWQLISNVYDKEYGLLR
TSQPCLYELPTQVGDMPAGTILLAGNIFDDDPYTQSRIVLYKSIDGGYTWSFLSEVDNGG
PCIYDPSTTSSTTTVWEPFLGMSASGELVCYYSDERQKSDGVLQAVSLKTSSDGVNWSGL
TNVTAINNTSDRPGMITVTELPNGRYMATYEMVNRPSLSKNNAVVYCKFSDDGVTWDAGS
PGTRVALADGRGIGSSPYVKWIDAGGPNGMVVISAKWGTDSSDNISGGQNFYVNYNLGQG
AWERLPMAVTYDYNDLAGGYFSGFSQSFDVSPDNTTLYQATNVENFNNSKIIDGVSYNLN
DVRVGTLPLKGCIYEAEKAVITNAQAGNAIDASNGQEVQYINESDSAVDFQNIKVENAGN
YNILVRYSNGEGTEASHTVSVNGTEIGTVNYPVTVNWDRYLWSSFTCYLNSGTNSVKFAK
NVGFAELDCIQVSETSDDFSVINKNSGKYLEIKSALTNEGAEAGQWGITDHWCQKWNFEE
AGNGGYRIKNMNSGLYLDIEGQSAADGAKAIQNDYAESDSQIWLLEETEGGYCHIVNKNS
GKYLEVFSNSAEDGASVGQWGATEYGCQEWTLIKEGIH

Enzyme Prediction     

No EC number prediction in MGYG000000176_01981.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH93	49	350	5.7e-85	0.8957654723127035
CBM13	557	694	3.1e-23	0.6914893617021277
CBM35	434	552	5.2e-23	0.9915966386554622

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam14200	RicinB_lectin_2	4.86e-27	593	680	2	89	Ricin-type beta-trefoil lectin domain-like.
pfam14200	RicinB_lectin_2	1.05e-17	552	632	8	88	Ricin-type beta-trefoil lectin domain-like.
cd04083	CBM35_Lmo2446-like	7.60e-15	434	552	3	125	Carbohydrate Binding Module 35 (CBM35) domains similar to Lmo2446. This family includes carbohydrate binding module 35 (CBM35) domains that are appended to several carbohydrate binding enzymes. Some CBM35 domains belonging to this family are appended to glycoside hydrolase (GH) family domains, including glycoside hydrolase family 31 (GH31), for example the CBM35 domain of Lmo2446, an uncharacterized protein from Listeria monocytogenes EGD-e. These CBM35s are non-catalytic carbohydrate binding domains that facilitate the strong binding of the GH catalytic modules with their dedicated, insoluble substrates. GH31 has a wide range of hydrolytic activities such as alpha-glucosidase, alpha-xylosidase, 6-alpha-glucosyltransferase, or alpha-1,4-glucan lyase, cleaving a terminal carbohydrate moiety from a substrate that may be a starch or a glycoprotein. Most characterized GH31 enzymes are alpha-glucosidases.
cd04081	CBM35_galactosidase-like	9.42e-15	434	552	3	125	Carbohydrate Binding Module family 35 (CBM35); appended mainly to enzymes that bind alpha-D-galactose (CBM35-Gal), including glycoside hydrolase (GH) families GH27 and GH43. This family includes carbohydrate binding module family 35 (CBM35); these are non-catalytic carbohydrate binding domains that are appended mainly to enzymes that bind alpha-D-galactose (CBM35-Gal), including glycoside hydrolase (GH) families GH27 and GH43. Examples of proteins which contain CBM35s belonging to this family includes the CBM35 of an exo-beta-1,3-galactanase from Phanerochaete chrysosporium 9 (Pc1,3Gal43A) which is appended to a GH43 domain, and the CBM35 domain of two bifunctional proteins with beta-L-arabinopyranosidase/alpha-D-galactopyranosidase activities from Fusarium oxysporum 12S, Foap1 and Foap2 (Fo/AP1 and Fo/AP2), that are appended to GH27 domains. CBM35s are unique in that they display conserved specificity through extensive sequence similarity but divergent function through their appended catalytic modules. They are known to bind alpha-D-galactose (Gal), mannan (Man), xylan, glucuronic acid (GlcA), a beta-polymer of mannose, and possibly glucans, forming four subfamilies based on general ligand specificities (galacto, urono, manno, and gluco configurations). Some CBM35s bind their ligands in a calcium-dependent manner. In contrast to most CBMs that are generally rigid proteins, CBM35 undergoes significant conformational change upon ligand binding. GH43 includes beta-xylosidases and beta-xylanases, using aryl-glycosides as substrates, while family GH27 includes alpha-galactosidases, alpha-N-acetylgalactosaminidases, and isomaltodextranases.
cd04082	CBM35_pectate_lyase-like	4.42e-11	433	552	2	124	Carbohydrate Binding Module family 35 (CBM35), pectate lyase-like; appended mainly to enzymes that bind mannan (Man), xylan, glucuronic acid (GlcA) and possibly glucans. This family includes carbohydrate binding module family 35 (CBM35) domains that are non-catalytic carbohydrate binding domains that are appended mainly to enzymes that bind mannan (Man), xylan, glucuronic acid (GlcA) and possibly glucans. Included in this family are CBM35s of pectate lyases, including pectate lyase 10A from Cellvibrio japonicas, these enzymes release delta-4,5-anhydrogalaturonic acid (delta4,5-GalA) from pectin, thus identifying a signature molecule for plant cell wall degradation. CBM35s are unique in that they display conserved specificity through extensive sequence similarity but divergent function through their appended catalytic modules. They are known to bind alpha-D-galactose (Gal), mannan (Man), xylan, glucuronic acid (GlcA), a beta-polymer of mannose, and possibly glucans, forming four subfamilies based on general ligand specificities (galacto, urono, manno, and gluco configurations). In contrast to most CBMs that are generally rigid proteins, CBM35 undergoes significant conformational change upon ligand binding. Some CBM35s bind their ligands in a calcium-dependent manner, especially those binding uronic acids.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QJU16706.1	0.0	1	608	1	611
QJA00803.1	1.04e-206	10	597	9	589
BAJ74916.1	4.29e-203	2	603	9	605
SDT10365.1	8.87e-203	25	604	34	606
QZD56017.1	6.92e-199	9	596	19	598

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3A71_A	4.80e-45	47	373	15	314	Highresolution structure of Penicillium chrysogenum alpha-L-arabinanase [Penicillium chrysogenum],3A72_A High resolution structure of Penicillium chrysogenum alpha-L-arabinanase complexed with arabinobiose [Penicillium chrysogenum]
2YDT_A	7.37e-35	93	371	57	323	ChainA, Exo-1,5-alpha-l-arabinofuranobiosidase [Fusarium graminearum],5M1Z_A Chain A, Exo-1,5-alpha-L-arabinofuranobiosidase [Fusarium graminearum]
2W5N_A	3.43e-34	93	371	57	323	ChainA, Alpha-l-arabinofuranosidase [Fusarium graminearum]
2YDP_A	4.66e-34	93	371	57	323	ChainA, Exo-1,5-alpha-l-arabinofuranobiosidase [Fusarium graminearum],2YDP_B Chain B, Exo-1,5-alpha-l-arabinofuranobiosidase [Fusarium graminearum],2YDP_C Chain C, Exo-1,5-alpha-l-arabinofuranobiosidase [Fusarium graminearum]
2W5O_A	1.35e-32	93	371	57	323	ChainA, ALPHA-L-ARABINOFURANOSIDASE [Fusarium graminearum]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000595	0.934059	0.064483	0.000360	0.000255	0.000219

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000176_01981.