CAZyme Information: MGYG000000174_04237

Basic Information

• Species: Parabacteroides faecis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Tannerellaceae; Parabacteroides; Parabacteroides faecis
• CAZyme ID: MGYG000000174_04237
• CAZy Family: GH120
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
629	MGYG000000174_18|CGC2	70695.41	6.3464

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000174	6515019	Isolate	China	Asia

• Gene Location: Start: 87041; End: 88930 Strand: +

Full Sequence      

MKRKQLFFILFLICCAVVQAKEYHVSVKGNDANEGTEKAPFRTIGKAAEYAFPGDVITVH
AGTYREWINPPRGGESDGKRIVYRAAPGEKVEIKGSERITGWTKEKDGVWKVTIPNTFFG
DYNPYADLIYGDWFDGMGREHHTGEVFLNNKSLYEKESLDKVLRPVPHENGKDKEGAAYT
WYCENDGVNTIIWANFHKYDPNKELVEISTRNTCFYPSKPGIDYLTIQGFYISQAATQWG
APTAEQIGMIATHWNKGWIIENNVISNSKCSGITLGKERQTGHNVWLNDTSIDGSLHYIE
VTFNTIRNGWNKENIGSHIVRNNEISHCEQTGICGSMGAAFSLIENNHIHDIWVKRQFTG
AEIGGIKFHAAVDTRIVHNRIHNAGRALWLDWMTQGTRVSGNLFYDNDMEDLFLEVNHGP
FLVDNNIFTSRRSILEQSQGGAYVHNLIAGDIYRYVEHGRYTPYFLPHSTEVAGLSIIPG
GDDRYINNLFATVLPVTEGENKRKYGLADYNKTVYPMMVDGNVYYNGALPFEGEKNKVVL
PDFNPNVKIEETADGVYLSLSVKGLSDLQTSRVNTERLGKAKLPGQAYEQPDGSPIEIAA
DYLGNARGDQPKPGPLESVKDGEIRIKVW

Enzyme Prediction     

No EC number prediction in MGYG000000174_04237.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH120	317	407	1.7e-33	0.989010989010989

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam13229	Beta_helix	2.53e-08	297	430	9	136	Right handed beta helix region. This region contains a parallel beta helix region that shares some similarity with Pectate lyases.
pfam07602	DUF1565	5.09e-06	27	66	1	40	Protein of unknown function (DUF1565). These proteins share a region of homology in their N termini, and are found in several phylogenetically diverse bacteria and in the archaeon Methanosarcina acetivorans. Some of these proteins also contain characterized domains such as pfam00395 and pfam03422.
pfam13229	Beta_helix	4.34e-04	259	407	35	137	Right handed beta helix region. This region contains a parallel beta helix region that shares some similarity with Pectate lyases.
pfam05048	NosD	0.002	250	408	44	171	Periplasmic copper-binding protein (NosD). NosD is a periplasmic protein which is thought to insert copper into the exported reductase apoenzyme (NosZ). This region forms a parallel beta helix domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ARV16552.1	9.37e-277	4	629	3	644
QOY88336.1	6.94e-257	10	629	35	663
AOW11377.1	2.98e-254	11	629	3	627
SDS19086.1	3.42e-235	20	629	24	644
QWX84993.1	8.57e-220	9	629	9	649

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3VST_A	4.45e-197	22	629	2	638	Thecomplex structure of XylC with Tris [Thermoanaerobacterium saccharolyticum JW/SL-YS485],3VST_B The complex structure of XylC with Tris [Thermoanaerobacterium saccharolyticum JW/SL-YS485],3VST_C The complex structure of XylC with Tris [Thermoanaerobacterium saccharolyticum JW/SL-YS485],3VST_D The complex structure of XylC with Tris [Thermoanaerobacterium saccharolyticum JW/SL-YS485],3VSU_A The complex structure of XylC with xylobiose [Thermoanaerobacterium saccharolyticum JW/SL-YS485],3VSU_B The complex structure of XylC with xylobiose [Thermoanaerobacterium saccharolyticum JW/SL-YS485],3VSU_C The complex structure of XylC with xylobiose [Thermoanaerobacterium saccharolyticum JW/SL-YS485],3VSU_D The complex structure of XylC with xylobiose [Thermoanaerobacterium saccharolyticum JW/SL-YS485],3VSV_A The complex structure of XylC with xylose [Thermoanaerobacterium saccharolyticum JW/SL-YS485],3VSV_B The complex structure of XylC with xylose [Thermoanaerobacterium saccharolyticum JW/SL-YS485],3VSV_C The complex structure of XylC with xylose [Thermoanaerobacterium saccharolyticum JW/SL-YS485],3VSV_D The complex structure of XylC with xylose [Thermoanaerobacterium saccharolyticum JW/SL-YS485]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000994	0.736215	0.261822	0.000365	0.000304	0.000265

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000174_04237.