CAZyme Information: MGYG000000174_04148

Basic Information

• Species: Parabacteroides faecis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Tannerellaceae; Parabacteroides; Parabacteroides faecis
• CAZyme ID: MGYG000000174_04148
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
767	MGYG000000174_17|CGC1	87612.49	8.0795

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000174	6515019	Isolate	China	Asia

• Gene Location: Start: 34415; End: 36718 Strand: +

Full Sequence      

MKKYILLTLFIFTALHLSAVDLNGVKWISIEKTLTKPNQWICYRKAFTLEKAEKTAMLTI
SVDSKYWLWVNGKLVVFEGGLKRGPNPNDTYFDRLDIASYLKKGNNTIAILMWYWGKDGF
CHKNSGSPGLLAKLQSGNREIISDATWKVKVHPAYGESQEPLPNYRLPESNIHFDARKDI
PDWMKPEYDDSNWQQATIAGSYPCQPWNQIHPRPFPNWYDSGLTEYVSVERSFKSDTLII
KAKLPRNISVTPYFEIEANEGLFIDIRSDNYKGGSEYNVRAEYVTKKGKQSFEAFNYVNG
HAIIYTIPPGVKVNKVAYRETRFNTEHVGSFECDDIFLNTLWQKSLNTMNLNMRDAIQDP
DRERSQWWGDAVIVSGEILYSCDSNAHGLIQKAIRNLVDWQRIDSVLYSPVPAGSWAREL
PLQMLASIGKFGMWNYYLYTGDTETIRHAYPAVKRYLAKWKTDERNLVIHRPGDWDWGDW
GENIDLPVLDNAWYCLALEGAQNMASILGYKEDASVYHQQIKTIKQAVNTFYWNGKVYCS
SDFQESPDDRANGLAVLAGFADSDKWKSIKTFLTDNFHASPYMEKYILEAFFVSGDVQGG
LDRMKKRYKYMVGHPLTTLWEDWQIGGAGGGSINHGWAGGPLSLLSQYIGGISPLEAEWN
KILIKPMLGNLKQVVCTVPTKTGTITATIKNQTGHLYSIDVTNTDNKIIHIAFPKDKIKQ
SLVINGRKYENNQLSSINQHSVKYLKSDESYHYFEIKNPTINISATH

Enzyme Prediction     

EC	3.2.1.40

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	255	702	5.1e-81	0.9007936507936508
CBM67	26	207	1.1e-45	0.9886363636363636

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	1.33e-32	326	649	1	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	1.06e-13	51	199	1	153	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam04685	DUF608	1.78e-05	400	553	83	228	Glycosyl-hydrolase family 116, catalytic region. This represents a family of archaeal, bacterial and eukaryotic glycosyl hydrolases, that belong to superfamily GH116. The primary catabolic pathway for glucosylceramide is catalysis by the lysosomal enzyme glucocerebrosidase. In higher eukaryotes, glucosylceramide is the precursor of glycosphingolipids, a complex group of ubiquitous membrane lipids. Mutations in the human protein cause motor-neurone defects in hereditary spastic paraplegia. The catalytic nucleophile, identified in UniProtKB:Q97YG8_SULSO, is a glutamine-335, with the likely acid/base at Asp-442 and the aspartates at Asp-406 and Asp-458 residues also playing a role in the catalysis of glucosides and xylosides that are beta-bound to hydrophobic groups. The family is defined as GH116, which presently includes enzymes with beta-glucosidase, EC:3.2.1.21, beta-xylosidase, EC:3.2.1.37, and glucocerebrosidase EC:3.2.1.45 activity.
COG3408	GDB1	7.80e-05	367	539	298	468	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].
pfam06202	GDE_C	0.006	435	548	95	226	Amylo-alpha-1,6-glucosidase. This family includes human glycogen branching enzyme AGL. This enzyme contains a number of distinct catalytic activities. It has been shown for the yeast homolog GDB1 that mutations in this region disrupt the enzymes Amylo-alpha-1,6-glucosidase (EC:3.2.1.33).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QTN32968.1	2.03e-259	38	694	207	867
AGY53286.1	4.62e-240	3	734	5	747
QLG44645.1	1.64e-239	17	712	18	718
QDH54696.1	2.70e-238	37	692	33	686
QNL36670.1	1.42e-235	11	692	8	686

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6I60_A	1.60e-24	43	715	179	900	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]
2OKX_A	3.06e-19	24	216	7	196	Crystalstructure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1],2OKX_B Crystal structure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1]
3W5M_A	9.76e-14	92	669	356	950	CrystalStructure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q82PP4	5.31e-13	92	669	356	950	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1
T2KPL4	7.08e-11	43	733	187	925	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000335	0.998979	0.000158	0.000173	0.000149	0.000149

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000174_04148.