CAZyme Information: MGYG000000174_00781

Basic Information

• Species: Parabacteroides faecis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Tannerellaceae; Parabacteroides; Parabacteroides faecis
• CAZyme ID: MGYG000000174_00781
• CAZy Family: GH101
• CAZyme Description: Endo-alpha-N-acetylgalactosaminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1127	MGYG000000174_1|CGC17	127858.4	6.1142

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000174	6515019	Isolate	China	Asia

• Gene Location: Start: 924013; End: 927396 Strand: -

Full Sequence      

MNKILTIGAFCLISVTSYASLQPEKGVNDSSYTWYLKSGQDSLAWVDGFSAVNSTVEFDL
LPQNSSAQVGVLLRYVNENDWIYVGCDKATDHLGFAFWYVETPDGKTEIARDIAKLYARH
LRRIKVNCIGRTLTVYVDGEQIAHKYIPNLPLSSGRTGFRVHDKGNVQISNVVCREVKEP
KKEIAKKKSSYILSSSRMEVLLNKDFPSVQSYLWKENQSRLDGQPFDVKAIQINGDHYLP
QVTSKTEADRVLYTLKVKEIGITIKVCCQVTDNVFQLSVTGIEERDDFKVKTLAFPDHNL
VSVPETVPGSCLSIADNVHKDRFYPLKEKSVDNTCQYGSILLLNSDKLVATLESNSMYTT
RQFLYQSVQTPGPVVTGIWGNEWIYRGHDGEAVDLPYIKVILSDDCNQDNKVDWQDGAIA
LQRVYPAPFGVDRIQNSYATITMNFASCAQYPFLRQLDNIKKFYLATDGFGQMLELKGYQ
SEGHDSAHPDYSGNYNERAGGKDDLAFLAKEARKYNAHIGVHINHSESYPEARAFNDRIV
TDMPAWSWLDQSYFLNKEADMLAGTFEERLNRLKTDVPDLSFVYLDTYREYRWLAHRTAG
LFNRNGWAVWTEDADVFDKEAVWIHYNPEAKSLIHRFVHHQYRDGYAVHPALLGGYNRGA
EIGFMGWQKGRDFKGVIRNFFTKQLPYRYLMHYPVLQLDTARAVLQGGLLAVGDGKNGTL
IKREGQILMTGDCVFIPWNPETEEKIYHYNVRGGKTAWQLPASWQQQETVYLYELNDLGR
KLAGTLPVRNGQIEIDALPDKGYIVYKQEMAPLPEMIWSEGSPVKDTGFDSQSFDYWKKQ
GATDALAVRETVYGQDYLEIKGMDAAGVSQVVNGLIPGKEYVASVWVNVIGRKEAVLAIQ
SGKTLSERTSISESRVMNFTDNTDRFRTTWQRLKIPFRMPAGEKEIVLSLNGGIASEDTA
AVCFDDVRLVECRQAQKTGYAYFEDFEYVDEGWGPFIACQPSAFTTHLSQKHDVYTDNTI
HGNWSLATWRERNGEVYRTSPSMIRFAPGQEYEVEFDYKVDTKDVYKVVGKSLSTGKEVF
SYELNRPGKCNVRFTTPDCTDFYIAVVKEGNGLLVIDDFGIKGELIK

Enzyme Prediction     

No EC number prediction in MGYG000000174_00781.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH101	196	704	2.3e-111	0.7977369165487977

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam12905	Glyco_hydro_101	7.59e-91	415	677	1	273	Endo-alpha-N-acetylgalactosaminidase. Virulence of pathogenic organisms such as the Gram-positive Streptococcus pneumoniae is largely determined by the ability to degrade host glycoproteins and to metabolize the resultant carbohydrates. This family is the enzymatic region, EC:3.2.1.97, of the cell surface proteins that specifically cleave Gal-beta-1,3-GalNAc-alpha-Ser/Thr (T-antigen, galacto-N-biose), the core 1 type O-linked glycan common to mucin glycoproteins. This reaction is exemplified by the S. pneumoniae protein Endo-alpha-N-acetylgalactosaminidase, where Asp764 is the catalytic nucleophile-base and Glu796 the catalytic proton donor.
cd14244	GH_101_like	1.20e-84	428	700	2	298	Endo-a-N-acetylgalactosaminidase and related glcyosyl hydrolases. This family contains the enzymatically active domain of cell surface proteins that specifically cleave Gal-beta-1,3-GalNAc-alpha-Ser/Thr (T-antigen, galacto-N-biose), the core 1 type O-linked glycan common to mucin glycoproteins (EC:3.2.1.97). It has been classified as glycosyl hydrolase family 101 in the Cazy resource. Virulence of pathogenic organisms such as the Gram-positive Streptococcus pneumoniae and other commensal human bacteria is largely determined by their ability to degrade host glycoproteins and to metabolize the resultant carbohydrates.
pfam18080	Gal_mutarotas_3	4.43e-43	193	414	1	243	Galactose mutarotase-like fold domain. This domain is found in endo-alpha-N-acetylgalactosaminidase present in Streptococcus pneumoniae. Endo-alpha-N-acetylgalactosaminidase is a cell surface-anchored glycoside hydrolase involved in the breakdown of mucin type O-linked glycans. The domain, known as domain 2, exhibits strong structural similarlity to the galactose mutarotase-like fold but lacks the active site residues. Domains, found in a number of glycoside hydrolases, structurally similar to domain 2 confer stability to the multidomain architectures.
pfam17451	Glyco_hyd_101C	4.41e-21	685	780	3	110	Glycosyl hydrolase 101 beta sandwich domain. Virulence of pathogenic organisms such as the Gram-positive Streptococcus pneumoniae is largely determined by the ability to degrade host glycoproteins and to metabolize the resultant carbohydrates. This family is the enzymatic region, EC:3.2.1.97, of the cell surface proteins that specifically cleave Gal-beta-1,3-GalNAc-alpha-Ser/Thr (T-antigen, galacto-N-biose), the core 1 type O-linked glycan common to mucin glycoproteins. This reaction is exemplified by a S. pneumoniae protein, where Asp764 is the catalytic nucleophile-base and Glu796 the catalytic proton donor. This domain represents C-terminal the beta sandwich domain.
pfam17974	GalBD_like	2.22e-15	965	1069	1	125	Galactose-binding domain-like. Proteins containing a galactose-binding domain-like fold can be found in several different protein families, in both eukaryotes and prokaryotes. The common function of these domains is to bind to specific ligands, such as cell-surface-attached carbohydrate substrates for galactose oxidase and sialidase, phospholipids on the outer side of the mammalian cell membrane for coagulation factor Va, membrane-anchored ephrin for the Eph family of receptor tyrosine kinases, and a complex of broken single-stranded DNA and DNA polymerase beta for XRCC1. The structure of the galactose-binding domain-like members consists of a beta-sandwich, in which the strands making up the sheets exhibit a jellyroll fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATP57185.1	0.0	53	1127	78	1136
AZN39795.1	3.74e-274	47	1125	48	1153
QHW33475.1	7.39e-262	58	1121	68	1207
AQT69519.1	1.19e-225	189	1069	47	927
ATD58436.1	3.71e-217	53	1118	547	1620

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6QEP_A	1.76e-103	189	1068	8	1038	EngBFDARPin Fusion 4b H14 [Bifidobacterium longum]
2ZXQ_A	2.23e-103	189	1068	23	1053	Crystalstructure of endo-alpha-N-acetylgalactosaminidase from Bifidobacterium longum (EngBF) [Bifidobacterium longum]
6QEV_B	3.40e-103	193	1068	12	1038	EngBFDARPin Fusion 4b B6 [Bifidobacterium longum]
6SH9_B	3.40e-103	193	1068	12	1038	EngBFDARPin Fusion 4b D12 [Bifidobacterium longum subsp. longum JCM 1217]
6QFK_A	3.40e-103	193	1068	12	1038	EngBFDARPin Fusion 4b G10 [Bifidobacterium longum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A9WNA0	2.30e-122	193	1066	52	971	Putative endo-alpha-N-acetylgalactosaminidase OS=Renibacterium salmoninarum (strain ATCC 33209 / DSM 20767 / JCM 11484 / NBRC 15589 / NCIMB 2235) OX=288705 GN=RSal33209_1326 PE=3 SV=2
Q8DR60	4.24e-96	20	1071	138	1334	Endo-alpha-N-acetylgalactosaminidase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) OX=171101 GN=spr0328 PE=1 SV=1
Q2MGH6	4.55e-95	20	1071	138	1334	Endo-alpha-N-acetylgalactosaminidase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=SP_0368 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000221	0.999155	0.000154	0.000158	0.000147	0.000133

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000174_00781.