CAZyme Information: MGYG000000162_02690

Basic Information

• Species: Enterococcus_B durans
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Enterococcaceae; Enterococcus_B; Enterococcus_B durans
• CAZyme ID: MGYG000000162_02690
• CAZy Family: CE8
• CAZyme Description: Pectinesterase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
302	MGYG000000162_86|CGC1	34182.4	6.9892

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000162	3083618	Isolate	China	Asia

• Gene Location: Start: 6934; End: 7842 Strand: +

Full Sequence      

MKIEKWVSKKSEKNPAAFSTIQEGVAYMAKQPNETKKVLYIEEGVYLENVACRLANFTMS
GHGNVEIRGNHYAKQKLSDDSERGTFRTSTVLIEGNSITLENLTISNTAGPGEKVGQAVA
LFNMGHQTVVKNCRLSGYQDTLCTGPLPLLQKDGTPFVTPADDVHRFCRQLYEDCWIEGT
IDFIFGGAQADFIHCTIHSRQSNNVGYITAASTPQDQENGYHFKNCVVTADENTAPVYLG
RPWRPFAKVVFESCKMANHIHPAGWDNWQNKENEKSAYFFERNNWYPGTVIRPSWIHFER
RE

Enzyme Prediction     

No EC number prediction in MGYG000000162_02690.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	13	295	6.4e-78	0.90625

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01095	Pectinesterase	1.31e-55	18	295	12	274	Pectinesterase.
PLN02773	PLN02773	2.77e-50	18	289	17	270	pectinesterase
COG4677	PemB	2.96e-49	16	288	92	376	Pectin methylesterase and related acyl-CoA thioesterases [Carbohydrate transport and metabolism, Lipid transport and metabolism].
PLN02301	PLN02301	2.14e-42	18	295	248	510	pectinesterase/pectinesterase inhibitor
PLN02416	PLN02416	5.58e-42	1	295	204	504	probable pectinesterase/pectinesterase inhibitor

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ASV95312.1	6.64e-234	1	302	1	302
QPQ27638.1	2.60e-231	1	302	1	302
QJS43752.1	7.14e-131	1	301	3	303
QEN53172.1	7.14e-131	1	301	3	303
QAT23984.1	7.14e-131	1	301	3	303

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1XG2_A	7.40e-31	18	295	15	277	ChainA, Pectinesterase 1 [Solanum lycopersicum]
1GQ8_A	2.88e-25	18	299	19	285	Pectinmethylesterase from Carrot [Daucus carota]
5C1E_A	5.48e-25	18	284	19	261	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]
5C1C_A	2.81e-24	18	284	19	261	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]
2NSP_A	7.12e-23	7	291	7	313	ChainA, Pectinesterase A [Dickeya dadantii 3937],2NSP_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NST_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NST_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT6_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT6_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT9_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT9_B Chain B, Pectinesterase A [Dickeya dadantii 3937]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9LVQ0	3.07e-37	84	289	90	270	Pectinesterase 31 OS=Arabidopsis thaliana OX=3702 GN=PME31 PE=1 SV=1
Q3EAY9	2.44e-34	18	299	199	463	Probable pectinesterase 30 OS=Arabidopsis thaliana OX=3702 GN=PME30 PE=2 SV=1
Q1PEC0	6.20e-34	18	299	226	490	Probable pectinesterase/pectinesterase inhibitor 42 OS=Arabidopsis thaliana OX=3702 GN=PME42 PE=2 SV=1
O48711	7.69e-34	18	298	248	513	Probable pectinesterase/pectinesterase inhibitor 12 OS=Arabidopsis thaliana OX=3702 GN=PME12 PE=2 SV=1
Q1JPL7	8.37e-34	18	299	257	523	Pectinesterase/pectinesterase inhibitor 18 OS=Arabidopsis thaliana OX=3702 GN=PME18 PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000062	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000162_02690.