CAZyme Information: MGYG000000155_01559

Basic Information

• Species: Weissella confusa
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Lactobacillaceae; Weissella; Weissella confusa
• CAZyme ID: MGYG000000155_01559
• CAZy Family: CBM50
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
281	MGYG000000155_7|CGC3	29338.79	4.167

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000155	2346100	Isolate	China	Asia

• Gene Location: Start: 100308; End: 101153 Strand: -

Full Sequence      

MQNVNSRKKMYKSGKNWVAAAVVAAAAAVAPMISTESAYANEEVAQTTSSWRAKTVDQVV
EAVQAAGQKYTVQAGDTLSTIASATELTTEEIASANNISDANFIVIGQEINLTKEVAEEV
VSEAPVAQEAAVEVAPVVAEVAAPVATQEVAVSEAPVAQEVQQPAAPSYNADYTAVPGNS
YYAGQCTWYVKNQLPWVGNFWGNAAEWANNATYAGRVVDTNPAVGTVAVMMPGVAYASSY
GHVAVVTGVNGDMITISEMNAKGEFVVSSRTIPAAGVLFIH

Enzyme Prediction     

No EC number prediction in MGYG000000155_01559.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK08581	PRK08581	6.20e-25	172	275	498	608	amidase domain-containing protein.
COG3942	COG3942	6.37e-23	179	277	66	164	Surface antigen [Cell wall/membrane/envelope biogenesis].
pfam05257	CHAP	2.13e-21	177	260	1	83	CHAP domain. This domain corresponds to an amidase function. Many of these proteins are involved in cell wall metabolism of bacteria. This domain is found at the N-terminus of Escherichia coli gss, where it functions as a glutathionylspermidine amidase EC:3.5.1.78. This domain is found to be the catalytic domain of PlyCA. CHAP is the amidase domain of bifunctional Escherichia coli glutathionylspermidine synthetase/amidase, and it catalyzes the hydrolysis of Gsp (glutathionylspermidine) into glutathione and spermidine.
smart00257	LysM	1.71e-11	69	112	1	44	Lysin motif.
cd00118	LysM	2.54e-11	68	112	1	45	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBZ02138.1	4.48e-176	1	281	1	281
QIE78146.1	1.43e-172	1	281	1	281
QYU57431.1	3.54e-169	1	281	1	274
QBZ04070.1	4.39e-151	1	281	1	272
QBZ04977.1	9.07e-113	1	281	1	281

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2LRJ_A	1.85e-16	178	275	8	103	ChainA, Staphyloxanthin biosynthesis protein, putative [Staphylococcus aureus subsp. aureus COL]
2K3A_A	3.72e-16	163	274	34	143	ChainA, CHAP domain protein [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305 = NCTC 7292]
4CGK_A	3.35e-14	179	270	285	372	Crystalstructure of the essential protein PcsB from Streptococcus pneumoniae [Streptococcus pneumoniae D39],4CGK_B Crystal structure of the essential protein PcsB from Streptococcus pneumoniae [Streptococcus pneumoniae D39]
5T1Q_A	6.08e-09	184	275	251	348	ChainA, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_B Chain B, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_C Chain C, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_D Chain D, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q2G0D4	2.00e-14	179	281	159	265	Probable autolysin SsaALP OS=Staphylococcus aureus (strain NCTC 8325 / PS 47) OX=93061 GN=SAOUHSC_00671 PE=1 SV=1
Q8DVU8	1.07e-12	179	264	103	184	Putative hydrolase SMU_367 OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) OX=210007 GN=SMU_367 PE=3 SV=1
Q2G278	4.08e-11	164	281	162	279	Probable autolysin LDP OS=Staphylococcus aureus (strain NCTC 8325 / PS 47) OX=93061 GN=SAOUHSC_00773 PE=1 SV=1
Q4L3C1	2.59e-10	179	281	223	329	N-acetylmuramoyl-L-alanine amidase sle1 OS=Staphylococcus haemolyticus (strain JCSC1435) OX=279808 GN=sle1 PE=3 SV=1
Q2YVT4	4.84e-10	43	274	133	325	N-acetylmuramoyl-L-alanine amidase sle1 OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) OX=273036 GN=sle1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000330	0.998926	0.000173	0.000206	0.000166	0.000150

TMHMM  Annotations     

start	end
13	35