CAZyme Information: MGYG000000155_00861

Basic Information

• Species: Weissella confusa
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Lactobacillaceae; Weissella; Weissella confusa
• CAZyme ID: MGYG000000155_00861
• CAZy Family: GH1
• CAZyme Description: Aryl-phospho-beta-D-glucosidase BglH

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
307	MGYG000000155_3|CGC2	35346.98	5.7851

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000155	2346100	Isolate	China	Asia

• Gene Location: Start: 159501; End: 160424 Strand: -

Full Sequence      

MAWTRIFPNGDDAQPNQKGLEFYDKIVDLCLSYGIEPLVTIQHFDTPMGLEKYGFWQGRE
VVDLFVRYAEVLLRHFDGRVRYWLTFNEINNMSTMPWNAGGISLDASENDKMQAAYHQFL
ASAKVVKLAHELNAENKVGMMYNGHFSYPNSPDPADVQGTEDFQKLMMFYADVQVRGKYP
NYKLKEFERKHIVLPEHTGDKDILAAGTVDFVSFSYYLTHVTGQKTQGILKGLNGLETGY
TNPYLKKSDWGWGINPQGLRFALNTLYYRYEKPVMIVENGLGAYDDKDADGQIHDDYRID
YIKQHLL

Enzyme Prediction     

EC	3.2.1.86	3.2.1.21	3.2.1.37

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	1	306	4.7e-85	0.6643356643356644

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG2723	BglB	5.38e-124	1	306	80	389	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
PRK09852	PRK09852	2.62e-113	1	306	92	400	cryptic 6-phospho-beta-glucosidase; Provisional
PRK09593	arb	7.33e-108	1	306	94	403	6-phospho-beta-glucosidase; Reviewed
PRK15014	PRK15014	1.25e-101	1	306	90	403	6-phospho-beta-glucosidase BglA; Provisional
PRK09589	celA	2.43e-100	1	306	88	402	6-phospho-beta-glucosidase; Reviewed

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBZ02606.1	3.02e-235	1	307	87	393
QYU56949.1	1.43e-233	1	307	87	393
APU64081.1	3.90e-231	1	307	87	393
APS26533.1	3.90e-231	1	307	87	393
ASS52537.1	3.90e-231	1	307	87	393

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6WGD_A	9.49e-104	1	306	87	396	Crystalstructure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_B Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_C Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis]
2XHY_A	2.36e-98	1	306	92	405	CrystalStructure of E.coli BglA [Escherichia coli K-12],2XHY_B Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_C Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_D Crystal Structure of E.coli BglA [Escherichia coli K-12]
4IPL_A	3.01e-89	1	307	99	413	Thecrystal structure of 6-phospho-beta-glucosidase BglA-2 from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4],4IPL_B The crystal structure of 6-phospho-beta-glucosidase BglA-2 from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4],4IPN_B The complex structure of 6-phospho-beta-glucosidase BglA-2 with thiocellobiose-6P from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4],4IPN_E The complex structure of 6-phospho-beta-glucosidase BglA-2 with thiocellobiose-6P from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4]
4F66_A	1.24e-86	1	306	91	406	Thecrystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans],4F66_B The crystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans]
4F79_A	3.48e-86	1	306	91	406	Thecrystal structure of 6-phospho-beta-glucosidase mutant (E375Q) in complex with Salicin 6-phosphate [Streptococcus mutans],4GPN_A The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159],4GPN_B The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P40740	1.07e-99	1	307	87	397	Aryl-phospho-beta-D-glucosidase BglH OS=Bacillus subtilis (strain 168) OX=224308 GN=bglH PE=1 SV=2
P24240	9.88e-99	1	306	92	400	6-phospho-beta-glucosidase AscB OS=Escherichia coli (strain K12) OX=83333 GN=ascB PE=3 SV=2
Q46829	1.29e-97	1	306	92	405	6-phospho-beta-glucosidase BglA OS=Escherichia coli (strain K12) OX=83333 GN=bglA PE=1 SV=2
Q46130	6.92e-96	1	307	86	399	6-phospho-beta-glucosidase OS=Clostridium longisporum OX=1523 GN=abgA PE=3 SV=1
P42973	2.34e-92	1	306	88	405	Aryl-phospho-beta-D-glucosidase BglA OS=Bacillus subtilis (strain 168) OX=224308 GN=bglA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000057	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000155_00861.