CAZyme Information: MGYG000000155_00410

Basic Information

• Species: Weissella confusa
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Lactobacillaceae; Weissella; Weissella confusa
• CAZyme ID: MGYG000000155_00410
• CAZy Family: CBM50
• CAZyme Description: putative transglycosylase IsaA

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
221		22616.63	3.7283

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000155	2346100	Isolate	China	Asia

• Gene Location: Start: 393257; End: 393922 Strand: -

Full Sequence      

MNKKMITALTVAGLATFAMAENASADTYTVQSGDTLSQIAANHNTTVDTLVANNNIADAN
VIFVGQQVEIDGVASNASYDATQADVAAVVASQAPVTQQVSYTAPVTTVDYSAQSQAPVA
QEVSYTAPVATTTTTAAASGSTYDQFIAAGGTDALWTAIVMPESGGNPDASNGQYKGLGQ
TNQSWGTGSVSDQTAGMLNYATSRYGSVDSAIAFRAANGWW

Enzyme Prediction     

No EC number prediction in MGYG000000155_00410.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd00118	LysM	8.16e-14	27	70	2	45	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.
smart00257	LysM	2.78e-12	27	70	1	44	Lysin motif.
pfam01476	LysM	9.88e-11	28	70	1	42	LysM domain. The LysM (lysin motif) domain is about 40 residues long. It is found in a variety of enzymes involved in bacterial cell wall degradation. This domain may have a general peptidoglycan binding function. The structure of this domain is known.
PRK13914	PRK13914	7.59e-05	1	75	1	76	invasion associated endopeptidase.
COG1388	LysM	1.08e-04	21	75	62	115	LysM repeat [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QYU57311.1	2.56e-127	1	221	1	221
QBZ02272.1	2.56e-127	1	221	1	221
QIE78323.1	2.56e-127	1	221	1	221
QBZ04241.1	1.47e-124	1	221	1	222
QDG80529.1	2.85e-97	1	221	1	235

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q4L980	5.91e-32	137	221	153	238	Probable transglycosylase IsaA OS=Staphylococcus haemolyticus (strain JCSC1435) OX=279808 GN=isaA PE=3 SV=1
A7IY64	1.02e-30	133	221	154	243	Probable transglycosylase IsaA OS=Staphylococcus xylosus OX=1288 GN=isaA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000225	0.999068	0.000182	0.000185	0.000176	0.000152

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000155_00410.