CAZyme Information: MGYG000000155_00154

Basic Information

• Species: Weissella confusa
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Lactobacillaceae; Weissella; Weissella confusa
• CAZyme ID: MGYG000000155_00154
• CAZy Family: GH1
• CAZyme Description: Aryl-phospho-beta-D-glucosidase BglA

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
483	MGYG000000155_1|CGC3	55856.97	4.5822

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000155	2346100	Isolate	China	Asia

• Gene Location: Start: 178748; End: 180199 Strand: -

Full Sequence      

MVKGYKMPDGFLWGAAVAAHQLEGAWDVDDKGVSIADVMLAGKHGVAREVTDEVLPDGNY
PNHRGIDFYHTYPEDFKLMKELGLKAFRTSIAWTRIYPNGDDVLPSEEGLRYYDKMIDAM
IENDIVPVLTLSHFEMPLHLVTEYGGFRNRQVIDFFVKFADTVIRRYGDRVKYWMTFNEI
NNQTSWMDPHPMLQNSGLKDYSEDEAQELMYQASHYELLASALVTKRAHEIAREKGCELL
VGDMIAMNPVYPASSKPEDILMAERAMQTRYFWGDVHANGKYPNWLKKFWAHKGFKIDIT
PEDEKILAENTVDYVAFSYYMSWTVSDTGDEWLEYDEEANHGDNPFLQKSDWGWQIDPVG
VRWAMNWMWDRWQKPMFIVENGFGAYDKLEENGEVHDDYRIAYFQGHIESMERAVVLDGI
PLIGYLPWSGIDIVSASTGEMLKRYGFIYVDLDDMGQGSGKRYRKDSFKWYQQVIASNGE
DLG

Enzyme Prediction     

EC	3.2.1.86	3.2.1.23	3.2.1.21

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	6	479	2e-137	0.9883449883449883

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK09589	celA	0.0	6	482	3	476	6-phospho-beta-glucosidase; Reviewed
PRK15014	PRK15014	0.0	2	482	1	477	6-phospho-beta-glucosidase BglA; Provisional
COG2723	BglB	0.0	5	481	2	456	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
PRK09852	PRK09852	2.30e-180	5	483	2	474	cryptic 6-phospho-beta-glucosidase; Provisional
PRK09593	arb	6.81e-167	8	482	7	477	6-phospho-beta-glucosidase; Reviewed

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QYU57182.1	0.0	1	483	1	483
QBZ02401.1	0.0	1	483	1	483
QBZ04430.1	0.0	1	483	1	483
QDG80351.1	0.0	1	483	1	483
APU64796.1	0.0	1	483	1	483

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4F66_A	1.39e-201	6	482	6	480	Thecrystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans],4F66_B The crystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans]
4F79_A	3.97e-201	6	482	6	480	Thecrystal structure of 6-phospho-beta-glucosidase mutant (E375Q) in complex with Salicin 6-phosphate [Streptococcus mutans],4GPN_A The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159],4GPN_B The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159]
3PN8_A	7.18e-192	6	482	6	480	Thecrystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 [Streptococcus mutans],3PN8_B The crystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 [Streptococcus mutans]
3QOM_A	1.99e-189	2	482	6	480	Crystalstructure of 6-phospho-beta-glucosidase from Lactobacillus plantarum [Lactiplantibacillus plantarum],4GZE_A Chain A, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_B Chain B, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_C Chain C, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_D Chain D, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_E Chain E, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_F Chain F, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1]
2XHY_A	3.27e-185	1	482	2	479	CrystalStructure of E.coli BglA [Escherichia coli K-12],2XHY_B Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_C Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_D Crystal Structure of E.coli BglA [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P42973	4.73e-187	6	482	3	479	Aryl-phospho-beta-D-glucosidase BglA OS=Bacillus subtilis (strain 168) OX=224308 GN=bglA PE=1 SV=1
Q46829	1.79e-184	1	482	2	479	6-phospho-beta-glucosidase BglA OS=Escherichia coli (strain K12) OX=83333 GN=bglA PE=1 SV=2
P40740	6.81e-162	6	482	7	469	Aryl-phospho-beta-D-glucosidase BglH OS=Bacillus subtilis (strain 168) OX=224308 GN=bglH PE=1 SV=2
P24240	1.26e-150	8	482	5	473	6-phospho-beta-glucosidase AscB OS=Escherichia coli (strain K12) OX=83333 GN=ascB PE=3 SV=2
Q48409	1.42e-144	8	482	5	462	Phospho-cellobiase OS=Klebsiella oxytoca OX=571 GN=casB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000069	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000155_00154.