CAZyme Information: MGYG000000153_01046

Basic Information

• Species: CAG-45 sp000438375
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; CAG-45; CAG-45 sp000438375
• CAZyme ID: MGYG000000153_01046
• CAZy Family: GH146
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
603	MGYG000000153_4|CGC1	68969.41	4.9465

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000153	2962513	Isolate	United Kingdom	Europe

• Gene Location: Start: 33690; End: 35501 Strand: -

Full Sequence      

MMLQAMETGKVHLLPGLFAERAEVNRAYLMELENQGLLQNFYLEAGIIMPGLQVVEDPET
ALLHWGWEAPTCQLRGHFLGHWMSAAAKLVAATGDVELKAKLIKIVDELEKCQKLNGGQW
IGPIPEKYFKKLEREEYIWSPQYVMHKTLLGLMHAYQYAGIEQSLAILDGISDWYVDWVK
DMEVKNPHAVYSGEEGGMLEVWATLYELTGEEKYLALAKAYDHPSIFRKLEEGKDALTNC
HANASIPWAHGAAKMYEITGDDRWKKLAEDFFRFAVTERGTYCTGGQNAGEFWVPPKMQG
HFLGDRNQEFCTVYNMVRLADYLYRFTGKAEYADYIEKNLYNGFLAQQNKHTGLPTYFLP
LRAGAKKKWGTKTRDFWCCYGTMVQAQTLYPELCCFSEEEKDRLVIGQYIPSEVTWGEGE
KRVTVSQSVDMKSYNAQAFFDEKDESQMSRWLLKFTVKANRHFTLSLRVPRWVKSAPEVT
INGQKPESMEITEGYLNLERDWAEDEITVYFPAGLTLENLPDAPELAAVLEGPIVLASLS
DADRGLKITGKPEDAIQPRYEHTYDVFPWQQSTYQTVGQAQNEKLVPLYDVTDESYTVYH
TIS

Enzyme Prediction     

No EC number prediction in MGYG000000153_01046.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH146	11	537	3.6e-164	0.9960238568588469

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07944	Glyco_hydro_127	2.69e-111	11	537	2	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
COG3533	COG3533	2.34e-64	10	538	11	502	Uncharacterized conserved protein, DUF1680 family [Function unknown].
cd04792	LanM-like	5.41e-04	205	288	604	693	Cyclases involved in the biosynthesis of class II lantibiotics, and similar proteins. LanM-like proteins. LanM is a bifunctional enzyme, involved in the synthesis of class II lantibiotics. It is responsible for both the dehydration and the cyclization of the precursor-peptide during lantibiotic synthesis. The C-terminal domain shows similarity to LanC, the cyclase component of the lan operon, but the N terminus seems to be unrelated to the dehydratase, LanB.
cd04791	LanC_SerThrkinase	0.004	150	270	93	229	Lanthionine synthetase C-like domain associated with serine/threonine kinases. Some members of this subgroup lack the zinc binding site and the active site residues, and therefore are most likely inactive. The function of this domain is unknown.
COG1331	YyaL	0.005	190	340	408	564	Uncharacterized conserved protein YyaL, SSP411 family, contains thoiredoxin and six-hairpin glycosidase-like domains [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADL50077.1	1.02e-293	2	599	1	599
CBL17727.1	1.03e-269	12	601	11	592
QUA54004.1	2.38e-248	2	599	1	599
QUC68168.1	7.03e-247	2	601	1	598
QTE71079.1	2.84e-246	2	601	1	598

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6YQH_AAA	1.85e-66	11	538	33	561	ChainAAA, Acetyl-CoA carboxylase, biotin carboxylase [Bacteroides thetaiotaomicron VPI-5482]
5OPJ_A	6.02e-64	11	538	33	561	Beta-L-arabinofuranosidase[Bacteroides thetaiotaomicron]
6EX6_A	6.92e-12	205	553	202	573	TheGH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482],6EX6_B The GH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482]
3WRE_A	2.33e-06	82	535	81	564	Thecrystal structure of native HypBA1 from Bifidobacterium longum JCM 1217 [Bifidobacterium longum subsp. longum JCM 1217],3WRG_A The complex structure of HypBA1 with L-arabinose [Bifidobacterium longum subsp. longum JCM 1217]
3WKW_A	2.35e-06	82	535	81	564	Crystalstructure of GH127 beta-L-arabinofuranosidase HypBA1 from Bifidobacterium longum ligand free form [Bifidobacterium longum subsp. longum JCM 1217],3WKX_A Crystal structure of GH127 beta-L-arabinofuranosidase HypBA1 from Bifidobacterium longum arabinose complex form [Bifidobacterium longum subsp. longum JCM 1217],7BZL_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217],7DIF_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217],7EXV_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217],7EXW_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000058	0.000003	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000153_01046.