CAZyme Information: MGYG000000153_00143

Basic Information

• Species: CAG-45 sp000438375
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; CAG-45; CAG-45 sp000438375
• CAZyme ID: MGYG000000153_00143
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
578	MGYG000000153_1|CGC2	67308.34	5.9627

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000153	2962513	Isolate	United Kingdom	Europe

• Gene Location: Start: 161768; End: 163504 Strand: +

Full Sequence      

MNDFDTVNMNKAQKTVYYLREYGFHYTMRRAMKKLGFKVDEDSEYMTWVRKQQCSTKELE
LQSKEKFPFMPKVTVYVEGCGEQAADAGFTKAAFKKQSYRVAKVKVALEQMSLDHLLNED
DADVFVFAAAGTKPRNQYIYDCVKAMNEDVKLLYAGEGKEDTFRPLLVYTDEDRITPDGK
RYVKPYFKPDMSLELLCNFQYVGGMFAVRRELLEQFRNTDVEVFGNGWYDLLFYCFEHTE
KIAHIQEVLFSRRGADTTRFGRSEDRGQKRYIERHLKRIGVDAVVENSEVPGFYHVKYQI
KGNPLLSIIIPNKDHIDILDQCIQSLLHHNNYQNFEIIIAENNSTEPETFEYYEKIKKVD
NRINIVYWKKEFNYSAINNFAAEFAAGELLLFLNNDTELISADSLTEMISYCYRPGVGAA
GAMLYYEDDTIQHGGVVIKIGGFAANALWSLTDRDERYYPYSVTAREFTACTAACLMMKK
SVFQKVGGFDEKLVVALNDVDICMKVRKSGELIMFNPYATLHHYESKSRGFENTPEKQER
FNREIAYFQSKWEKELEAGDPYYNRNQTLHRADYTMDY

Enzyme Prediction     

No EC number prediction in MGYG000000153_00143.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	307	486	3.9e-17	0.9882352941176471

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04186	GT_2_like_c	6.15e-36	308	525	1	166	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
COG1216	GT2	1.87e-25	302	562	1	258	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
cd04184	GT2_RfbC_Mx_like	2.91e-21	167	253	116	201	Myxococcus xanthus RfbC like proteins are required for O-antigen biosynthesis. The rfbC gene encodes a predicted protein of 1,276 amino acids, which is required for O-antigen biosynthesis in Myxococcus xanthus. It is a subfamily of Glycosyltransferase Family GT2, which includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds.
pfam00535	Glycos_transf_2	1.10e-16	307	483	1	164	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
cd04184	GT2_RfbC_Mx_like	2.59e-15	304	437	1	130	Myxococcus xanthus RfbC like proteins are required for O-antigen biosynthesis. The rfbC gene encodes a predicted protein of 1,276 amino acids, which is required for O-antigen biosynthesis in Myxococcus xanthus. It is a subfamily of Glycosyltransferase Family GT2, which includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUO33456.1	1.20e-144	12	576	224	810
CBL24563.1	1.98e-136	12	576	221	811
QUI96061.1	2.40e-133	5	576	117	713
QHB25117.1	5.23e-133	14	576	228	812
QRT31219.1	5.23e-133	14	576	228	812

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P55465	2.88e-83	167	576	481	897	Uncharacterized protein y4gI OS=Sinorhizobium fredii (strain NBRC 101917 / NGR234) OX=394 GN=NGR_a03550 PE=4 SV=1
Q50864	1.70e-69	167	573	434	837	O-antigen biosynthesis protein RfbC OS=Myxococcus xanthus OX=34 GN=rfbC PE=4 SV=1
P9WMY2	6.18e-09	415	530	120	242	N-acetylglucosaminyl-diphospho-decaprenol L-rhamnosyltransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=wbbL PE=3 SV=2
P9WMY3	6.18e-09	415	530	120	242	N-acetylglucosaminyl-diphospho-decaprenol L-rhamnosyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=wbbL PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000072	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000153_00143.