CAZyme Information: MGYG000000150_03065

Basic Information

• Species: Hungatella sp005845265
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Hungatella; Hungatella sp005845265
• CAZyme ID: MGYG000000150_03065
• CAZy Family: GH35
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
852	MGYG000000150_12|CGC2	96646.2	4.9692

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000150	7470188	Isolate	United Kingdom	Europe

• Gene Location: Start: 161564; End: 164122 Strand: -

Full Sequence      

MKLSNILLASSLFYFRIPREKWAKRMKLLKTAGYNTIDVYFPWNYHETAPGIWDFSGNRD
VYAFLELAKMHGLFVIARPGPYICSEWDGGGLPAWLAADGVSVRQDDEEFLKRIGTWYDH
ILPVLEPFQISRGGTVLCMQIENELDFFDCKSPVSYMEKLMSMAAGHRIDIPLFYCCGQN
DLLRAGGLTPGLYTAFNVYSDSNSPGTEERALHLYSTVSDRNMPFLITETNREHSYLKRL
LACGAKLLGPYNQTAGNTMEWYNGITNWGTRENPIALMAADYDFDSMIGSAGEVNDQFYE
SRLLSGLLNSFPTEFAESVPMKAEGMVIQSSQPVNAVIPLLHTTRGDFLELSNLGRKDTI
HLQYHDFELTLLMASLETRLLPVNVVLSDKKRITLLYSSYEIGFVEEKEDRTTTAMYGYG
DFIAVLDMDGEIKTVNGGYQDESFNLIVGSPKEIAVMPIPGLPDMKGKLEEQAEERVISH
LSIADAVLPAIKFEKTPVQPMEKIPQYRGIGCYRFSVEKDGEFLFQEAADIITICRDGEQ
TDVIYGRGDSIFRQLQPGIYQIYTEIWGHSNFDDIRCKSLRMNSLKGIGKIVRINGREDI
SDNWLFDLDEQPVGEWYFFRHSNYNTIMGIDSYSRAVSPVRGVYSKWITVPDNADSLYLH
FSRADCIIHVYVNGHLEADVLKDDPVVDISRYAKNDRIEVCLRTERKFSTDRVGNVTLIA
GNAQTDCEYGMLPVETFKMPLQAVQTTYPIKLRKGKNYVMTLPLERKDGKEMKLFFQGKD
IKLTIVNNHRVISRLVLPNGSFPDVRGGSRDTAYISEEWLGAEKPVIWCQTIGNEPELEE
VKVCYYSSVCDA

Enzyme Prediction     

No EC number prediction in MGYG000000150_03065.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH35	6	304	4.7e-74	0.9609120521172638

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01301	Glyco_hydro_35	3.87e-61	6	205	10	211	Glycosyl hydrolases family 35.
PLN03059	PLN03059	9.35e-22	6	144	45	186	beta-galactosidase; Provisional
COG1874	GanA	4.16e-19	2	144	12	160	Beta-galactosidase GanA [Carbohydrate transport and metabolism].
pfam02449	Glyco_hydro_42	1.14e-06	18	97	8	77	Beta-galactosidase. This group of beta-galactosidase enzymes belong to the glycosyl hydrolase 42 family. The enzyme catalyzes the hydrolysis of terminal, non-reducing terminal beta-D-galactosidase residues.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNO18225.1	1.41e-151	5	842	18	863
ADQ06408.1	1.87e-132	5	820	21	888
AFH64881.1	5.54e-132	6	841	41	945
AEI44801.1	5.95e-132	6	841	44	948
ALS29487.1	1.90e-131	6	830	26	902

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7KDV_A	1.76e-42	8	327	35	361	ChainA, Beta-galactosidase [Mus musculus],7KDV_C Chain C, Beta-galactosidase [Mus musculus],7KDV_E Chain E, Beta-galactosidase [Mus musculus],7KDV_G Chain G, Beta-galactosidase [Mus musculus],7KDV_I Chain I, Beta-galactosidase [Mus musculus],7KDV_K Chain K, Beta-galactosidase [Mus musculus]
3THC_A	3.09e-42	8	341	28	369	Crystalstructure of human beta-galactosidase in complex with galactose [Homo sapiens],3THC_B Crystal structure of human beta-galactosidase in complex with galactose [Homo sapiens],3THC_C Crystal structure of human beta-galactosidase in complex with galactose [Homo sapiens],3THC_D Crystal structure of human beta-galactosidase in complex with galactose [Homo sapiens],3THD_A Crystal structure of human beta-galactosidase in complex with 1-deoxygalactonojirimycin [Homo sapiens],3THD_B Crystal structure of human beta-galactosidase in complex with 1-deoxygalactonojirimycin [Homo sapiens],3THD_C Crystal structure of human beta-galactosidase in complex with 1-deoxygalactonojirimycin [Homo sapiens],3THD_D Crystal structure of human beta-galactosidase in complex with 1-deoxygalactonojirimycin [Homo sapiens]
3WEZ_A	3.94e-42	8	341	52	393	Crystalstructure of human beta-galactosidase in complex with NOEV [Homo sapiens],3WEZ_B Crystal structure of human beta-galactosidase in complex with NOEV [Homo sapiens],3WEZ_C Crystal structure of human beta-galactosidase in complex with NOEV [Homo sapiens],3WEZ_D Crystal structure of human beta-galactosidase in complex with NOEV [Homo sapiens],3WF0_A Crystal structure of human beta-galactosidase in complex with 6S-NBI-DGJ [Homo sapiens],3WF0_B Crystal structure of human beta-galactosidase in complex with 6S-NBI-DGJ [Homo sapiens],3WF0_C Crystal structure of human beta-galactosidase in complex with 6S-NBI-DGJ [Homo sapiens],3WF0_D Crystal structure of human beta-galactosidase in complex with 6S-NBI-DGJ [Homo sapiens],3WF1_A Crystal structure of human beta-galactosidase in complex with 6S-NBI-GJ [Homo sapiens],3WF1_B Crystal structure of human beta-galactosidase in complex with 6S-NBI-GJ [Homo sapiens],3WF1_C Crystal structure of human beta-galactosidase in complex with 6S-NBI-GJ [Homo sapiens],3WF1_D Crystal structure of human beta-galactosidase in complex with 6S-NBI-GJ [Homo sapiens],3WF2_A Crystal structure of human beta-galactosidase in complex with NBT-DGJ [Homo sapiens],3WF2_B Crystal structure of human beta-galactosidase in complex with NBT-DGJ [Homo sapiens],3WF2_C Crystal structure of human beta-galactosidase in complex with NBT-DGJ [Homo sapiens],3WF2_D Crystal structure of human beta-galactosidase in complex with NBT-DGJ [Homo sapiens]
3WF3_A	5.28e-42	9	341	53	393	Crystalstructure of human beta-galactosidase mutant I51T in complex with Galactose [Homo sapiens],3WF3_B Crystal structure of human beta-galactosidase mutant I51T in complex with Galactose [Homo sapiens],3WF3_C Crystal structure of human beta-galactosidase mutant I51T in complex with Galactose [Homo sapiens],3WF3_D Crystal structure of human beta-galactosidase mutant I51T in complex with Galactose [Homo sapiens],3WF4_A Crystal structure of human beta-galactosidase mutant I51T in complex with 6S-NBI-DGJ [Homo sapiens],3WF4_B Crystal structure of human beta-galactosidase mutant I51T in complex with 6S-NBI-DGJ [Homo sapiens],3WF4_C Crystal structure of human beta-galactosidase mutant I51T in complex with 6S-NBI-DGJ [Homo sapiens],3WF4_D Crystal structure of human beta-galactosidase mutant I51T in complex with 6S-NBI-DGJ [Homo sapiens]
4E8C_A	4.89e-38	7	337	19	355	Crystalstructure of streptococcal beta-galactosidase in complex with galactose [Streptococcus pneumoniae TIGR4],4E8C_B Crystal structure of streptococcal beta-galactosidase in complex with galactose [Streptococcus pneumoniae TIGR4],4E8D_A Crystal structure of streptococcal beta-galactosidase [Streptococcus pneumoniae TIGR4],4E8D_B Crystal structure of streptococcal beta-galactosidase [Streptococcus pneumoniae TIGR4]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9TRY9	2.16e-44	8	327	52	378	Beta-galactosidase OS=Canis lupus familiaris OX=9615 GN=GLB1 PE=1 SV=3
O19015	1.87e-42	8	327	52	378	Beta-galactosidase OS=Felis catus OX=9685 GN=GLB1 PE=2 SV=1
Q60HF6	5.15e-42	8	341	51	392	Beta-galactosidase OS=Macaca fascicularis OX=9541 GN=GLB1 PE=2 SV=1
P23780	1.17e-41	8	327	52	378	Beta-galactosidase OS=Mus musculus OX=10090 GN=Glb1 PE=1 SV=1
Q5R7P4	1.19e-41	8	341	51	392	Beta-galactosidase OS=Pongo abelii OX=9601 GN=GLB1 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000060	0.000008	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000150_03065.