CAZyme Information: MGYG000000150_02153

Basic Information

• Species: Hungatella sp005845265
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Hungatella; Hungatella sp005845265
• CAZyme ID: MGYG000000150_02153
• CAZy Family: GH3
• CAZyme Description: Thermostable beta-glucosidase B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
779	MGYG000000150_8|CGC2	85788.48	4.7569

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000150	7470188	Isolate	United Kingdom	Europe

• Gene Location: Start: 69671; End: 72010 Strand: +

Full Sequence      

MTDKIKDLVTAMTLEEKALLCSGKNFWQMEGIERLGIPSVMVTDGPHGLRKQAGEADHLG
LHQSVKATCFPPAVTSASSWDKAALYDMGQAIGEECVQEEVAVVLGPGTNIKRSPLCGRN
FEYFSEDPYLAGEMAAAWISGVQSKGIGTSLKHFAANNQEKARLVSNSVVDERALREIYL
APFEKAVKQAQPWTVMCSYNRINGVYSCENEWLLTEVLRNEWGFQGLVMTDWGAMNDRVK
ALKAGLELEMPGPDPYNDKKIVDAVRNGELDEAVLDRAAERLLTVIMRAGEVHKKEYDAA
AHHILARRIAAESAVLLKNDGMLPLKKENSYAVIGAFAETPRYQGAGSSRIHPHQIDCVL
DSLRESGIAFEYAPGYELEQDTINPVLLEEAAACAKGRDGILVFAGLPDSYESEGFDRTH
LNLPKSHTALIEAVTAVNPHVTVVLLCGSAILMPWRDRVESILLTYLGGEAAGSACADVL
TGTVNPSGRLAETFPLSLEDTPCCENFAGEGKDVEYRESILVGYRYYDWAEKPVAFPFGY
GLSYTSFSYDSMEIVWDEKEEKGEARITVTNTGETSGSEVVQLYIGKAQSGVMRAARELK
GFQKVFLEPGELREVVIGLDRRSFSCYDTNRSCWTVEAGTYQIYAASSSRDLKLKKDLML
PGKELSHIPGYDAAETVKDGHFAADRKQFKRLFPDELPLTPDDGRITLNTTVKEIMASEK
GKALLGGLVEGYSGRYSGDDDVSRMMLAMLQDMPLRSLAMFGAVEMETLEEMVREIGRP

Enzyme Prediction     

EC	3.2.1.21	3.2.1.-	3.2.1.45

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	31	251	1.4e-72	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	9.19e-94	34	653	101	758	beta-glucosidase BglX.
COG1472	BglX	1.58e-74	34	339	57	365	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
PLN03080	PLN03080	1.78e-66	8	620	56	743	Probable beta-xylosidase; Provisional
pfam01915	Glyco_hydro_3_C	1.09e-54	314	544	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
pfam00933	Glyco_hydro_3	1.47e-43	34	285	63	316	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AGS53563.1	3.08e-292	6	779	4	790
AGS53344.1	7.89e-290	6	779	4	789
AEF82048.1	1.51e-279	6	779	4	789
AFC28614.1	1.08e-268	1	776	1	754
AFH60784.1	3.09e-268	1	776	1	754

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7MS2_A	1.08e-256	1	776	1	751	ChainA, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	4.48e-212	1	662	1	665	CrystalStructure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
2X40_A	1.55e-142	3	655	2	708	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]
2X42_A	2.40e-141	3	655	2	708	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with alpha-D-glucose [Thermotoga neapolitana DSM 4359]
3AC0_A	9.22e-116	5	662	6	844	Crystalstructure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P14002	5.90e-256	1	776	1	751	Thermostable beta-glucosidase B OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=bglB PE=1 SV=2
F6C6C1	4.78e-210	1	662	1	674	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium breve (strain ACS-071-V-Sch8b) OX=866777 GN=HMPREF9228_1477 PE=1 SV=1
E7CY69	5.41e-209	1	652	1	664	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium longum OX=216816 GN=apy PE=1 SV=1
P27034	1.92e-135	5	661	2	811	Beta-glucosidase OS=Rhizobium radiobacter OX=358 GN=cbg-1 PE=3 SV=1
A7LXS8	6.44e-130	4	653	45	738	Beta-glucosidase BoGH3A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02644 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000058	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000150_02153.