CAZyme Information: MGYG000000150_01909

Basic Information

• Species: Hungatella sp005845265
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Hungatella; Hungatella sp005845265
• CAZyme ID: MGYG000000150_01909
• CAZy Family: GH2
• CAZyme Description: Beta-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
841	MGYG000000150_7|CGC4	96051.63	4.8927

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000150	7470188	Isolate	United Kingdom	Europe

• Gene Location: Start: 69534; End: 72059 Strand: +

Full Sequence      

MKKMVLREGWLLKRFPTGMDYSPEELEAGFRVPGTGKDRSFPVLNFPEQVHDVLLDYGVI
GNPNETGINRDLWIDEYDWVYRLEFTGDASAAAGGQVYLTLEGVDTFAAVYLNGTLVGKC
GDVFLDYRFPVNEVNPGANVLLIWIQSAAKKVSGIRLPERYEGRVPAISAVRAFRSGFHE
YCGPVPGLIRCGIYGDVTLMQEDPLLFDEVTADSSLSEDGDCGVVTITASFLGALEEYQG
EPLQARVFDSTGQVRAEEVRQIMSRSETMVLRVPHPKLWWPRTMGEPSVYRLELTCGSRT
ADFLEKVIGFRRVSLAGDMDFRINGRPLKLWGANLVHPDTLSNRYRPDVMGRLLDLAELG
NFNILRVWGESERYPEAFYEECDRRGILIWQDFYLCYTAYPEEAEFLELCRKEAEQMTKR
LKSHPSILLWCGGNETLLSRDYENPGGPCFGETIVRQVFPGVCMEQDPERYYHPSSPCGG
AYANDPLAGDTHGYTHLWFVPGREFPVFLSENCRVSTPSMKSMRKMMRPEELWPPEYTGR
VSRRQRKEWPETWELHNTNQGVIKLGPVEHYYDAGSADELVYRIGAAHAEYIHEQVCRFR
RGFRGEEAASAGTARRTKGHMLWKFNNNSNIISYGVVDYYQEPYYPYYELKRCYAPFLVS
CELGDHGYLWVTNDTGHAVNGHLEIFLFDILKNERQGTFFQKFYAEPDESKPVCTIDCYG
QFRKSNLVCAVAYSDEGEVMGMCAEPCEIERRMEYPEHTGLQLKQEGDILVVTASRFARC
VELGGDEDGDEFGWLFEDNYFDLLPGMEKRIRVLGRHERGTVTAKAVYDEDKAVLKYEKR
D

Enzyme Prediction     

No EC number prediction in MGYG000000150_01909.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	30	709	1.7e-73	0.6476063829787234

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	3.43e-52	45	498	33	482	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
PRK10150	PRK10150	5.20e-11	192	435	169	417	beta-D-glucuronidase; Provisional
pfam17753	Ig_mannosidase	1.99e-07	765	813	12	56	Ig-fold domain. This Ig-like fold domain is found in mannosidase enzymes.
pfam02836	Glyco_hydro_2_C	4.62e-07	321	435	8	135	Glycosyl hydrolases family 2, TIM barrel domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
pfam00703	Glyco_hydro_2	1.24e-04	210	311	6	106	Glycosyl hydrolases family 2. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBE99501.1	4.20e-278	26	828	6	800
QIB57903.1	9.02e-278	26	828	6	800
QMW77334.1	9.02e-278	26	828	6	800
QIB57902.1	4.37e-162	1	828	1	833
QMW77333.1	4.37e-162	1	828	1	833

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5N6U_A	1.85e-59	37	697	39	696	Crystalstructure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_B Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_C Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_D Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12]
2VJX_A	1.11e-51	26	811	11	814	Structuraland biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VJX_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VQT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VQT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VR4_A Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482],2VR4_B Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482]
2JE8_A	1.13e-51	26	811	13	816	Structureof a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],2JE8_B Structure of a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
7OP6_A	1.14e-51	26	811	13	816	ChainA, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP6_B Chain B, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP7_A Chain A, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP7_B Chain B, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482]
2WBK_A	2.74e-51	26	811	11	814	Structureof the Michaelis complex of beta-mannosidase, Man2A, provides insight into the conformational itinerary of mannoside hydrolysis [Bacteroides thetaiotaomicron VPI-5482],2WBK_B Structure of the Michaelis complex of beta-mannosidase, Man2A, provides insight into the conformational itinerary of mannoside hydrolysis [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
I2C092	2.47e-52	30	815	15	840	Beta-mannosidase B OS=Thermothelomyces thermophilus OX=78579 GN=man9 PE=1 SV=1
Q0CCA0	1.46e-50	42	815	28	828	Beta-mannosidase B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=mndB PE=3 SV=2
Q2TXB7	1.57e-49	42	705	28	702	Beta-mannosidase B OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=mndB PE=3 SV=3
B8NW36	2.11e-49	42	705	28	702	Beta-mannosidase B OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=mndB PE=3 SV=1
Q5B7W2	1.24e-48	5	685	8	698	Beta-mannosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=mndB PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000067	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000150_01909.