CAZyme Information: MGYG000000150_01866

Basic Information

• Species: Hungatella sp005845265
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Hungatella; Hungatella sp005845265
• CAZyme ID: MGYG000000150_01866
• CAZy Family: CE1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
272	MGYG000000150_7|CGC1	30381.43	5.3377

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000150	7470188	Isolate	United Kingdom	Europe

• Gene Location: Start: 12199; End: 13017 Strand: +

Full Sequence      

MALLNVDFYSYYLGMDSPLTVLLPEKRGRKPEASPDKKYPVLYLLHGHADDNTAWIRKSD
LELLVRDHDLIVVMPSAHRSFYTNGRYGHLYFDYITKELPVIVGNFFPASARREDTYIGG
LSMGGYGALKAALSCPEQYAGVAAMSAANSPFGAMKAAGPMFSVPDFMDNVYRIFGDEAE
YKGSKEDLEYLAKQAASSAGSGLKIYHSCGKQDPLYGLNVEFKQFMETECPELDYHYCEC
DGSHNWGFWNPQLKCILEYFGLIPASQDKSGT

Enzyme Prediction     

No EC number prediction in MGYG000000150_01866.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE1	13	258	9.3e-47	0.9559471365638766

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0627	FrmB	1.16e-32	33	260	48	308	S-formylglutathione hydrolase FrmB [Defense mechanisms].
pfam00756	Esterase	1.90e-28	10	253	1	239	Putative esterase. This family contains Esterase D. However it is not clear if all members of the family have the same function. This family is related to the pfam00135 family.
COG2382	Fes	1.24e-14	8	260	73	295	Enterochelin esterase or related enzyme [Inorganic ion transport and metabolism].
PLN02442	PLN02442	2.29e-10	31	151	39	180	S-formylglutathione hydrolase
COG3509	LpqC	2.01e-05	24	159	47	198	Poly(3-hydroxybutyrate) depolymerase [Secondary metabolites biosynthesis, transport and catabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QHS51382.1	7.51e-14	37	257	135	343
AWI08281.1	1.30e-10	2	253	139	375
QCX54224.1	1.30e-10	5	258	141	382
QCD34664.1	1.68e-10	34	253	168	363
QBR12665.1	2.43e-10	37	263	178	393

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4RGY_A	1.83e-60	1	264	2	265	Structuraland functional analysis of a low-temperature-active alkaline esterase from South China Sea marine sediment microbial metagenomic library [uncultured bacterium FLS12],4RGY_B Structural and functional analysis of a low-temperature-active alkaline esterase from South China Sea marine sediment microbial metagenomic library [uncultured bacterium FLS12]
4ROT_A	2.33e-41	1	269	8	266	Crystalstructure of esterase A from Streptococcus pyogenes [Streptococcus pyogenes]
7L0A_A	6.46e-39	1	259	9	257	ChainA, Esterase family protein [Staphylococcus aureus],7L0A_B Chain B, Esterase family protein [Staphylococcus aureus]
6VH9_A	3.05e-38	2	259	4	251	FphF,Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, apo form [Staphylococcus aureus],6VH9_B FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, apo form [Staphylococcus aureus],6VH9_C FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, apo form [Staphylococcus aureus],6VH9_D FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, apo form [Staphylococcus aureus],6VHD_A FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, KT129 bound [Staphylococcus aureus],6VHD_B FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, KT129 bound [Staphylococcus aureus],6VHD_C FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, KT129 bound [Staphylococcus aureus],6VHD_D FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, KT129 bound [Staphylococcus aureus],6VHE_A FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, KT130 bound [Staphylococcus aureus],6VHE_B FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, KT130 bound [Staphylococcus aureus],6VHE_C FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, KT130 bound [Staphylococcus aureus],6VHE_D FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, KT130 bound [Staphylococcus aureus],6WCX_A FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, substrate bound [Staphylococcus aureus],6WCX_B FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, substrate bound [Staphylococcus aureus],6WCX_C FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, substrate bound [Staphylococcus aureus],6WCX_D FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, substrate bound [Staphylococcus aureus]
2UZ0_A	8.64e-36	2	257	6	249	TheCrystal crystal structure of the estA protein, a virulence factor estA protein from Streptococcus pneumonia [Streptococcus pneumoniae],2UZ0_B The Crystal crystal structure of the estA protein, a virulence factor estA protein from Streptococcus pneumonia [Streptococcus pneumoniae],2UZ0_C The Crystal crystal structure of the estA protein, a virulence factor estA protein from Streptococcus pneumonia [Streptococcus pneumoniae],2UZ0_D The Crystal crystal structure of the estA protein, a virulence factor estA protein from Streptococcus pneumonia [Streptococcus pneumoniae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P23553	1.70e-36	1	263	1	264	Acetyl esterase OS=Caldicellulosiruptor saccharolyticus OX=44001 GN=xynC PE=4 SV=1
Q0TKS8	8.69e-13	9	151	20	174	S-formylglutathione hydrolase FrmB OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) OX=362663 GN=frmB PE=3 SV=1
Q8FKG2	8.69e-13	9	151	20	174	S-formylglutathione hydrolase FrmB OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) OX=199310 GN=frmB PE=3 SV=1
Q1RFI8	3.02e-12	9	151	20	174	S-formylglutathione hydrolase FrmB OS=Escherichia coli (strain UTI89 / UPEC) OX=364106 GN=frmB PE=3 SV=1
A1A834	3.02e-12	9	151	20	174	S-formylglutathione hydrolase FrmB OS=Escherichia coli O1:K1 / APEC OX=405955 GN=frmB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000046	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000150_01866.