CAZyme Information: MGYG000000149_02586

Basic Information

• Species: Clostridium saudiense
• Lineage: Bacteria; Firmicutes_A; Clostridia; Clostridiales; Clostridiaceae; Clostridium; Clostridium saudiense
• CAZyme ID: MGYG000000149_02586
• CAZy Family: CE4
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
296	MGYG000000149_39|CGC1	33069.88	4.167

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000149	3780856	Isolate	United Kingdom	Europe

• Gene Location: Start: 6087; End: 6977 Strand: +

Full Sequence      

MKKRFIAITFLLLITFGMIACGKNEVSKEENINETNQEQATGSQETTEEQQENPNKCGNT
EEQDQAQIEYINIAPEEVRIPILMYHSISDEDPSNNLLVPPAMFEEQMAWLEANNFTAMN
LDEALEAMETGKVPKRPVVITFDDGYADNYSSAFPSLKNHNLKATFFIITDGVDNGYYMS
SDNLKEMQAAGMSIENHTANHLELNGLSKEDAYDSIKRAQDYLRNVIGSDGNYLCYPVGK
YNDETIAIEEELGIKAAVTTQGGIASINDGIHTLKRVRISPMSIDSFASIFSEYIN

Enzyme Prediction     

No EC number prediction in MGYG000000149_02586.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE4	131	259	1.7e-35	0.9461538461538461

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd10918	CE4_NodB_like_5s_6s	3.56e-56	137	281	1	156	Putative catalytic NodB homology domain of PgaB, IcaB, and similar proteins which consist of a deformed (beta/alpha)8 barrel fold with 5- or 6-strands. This family belongs to the large and functionally diverse carbohydrate esterase 4 (CE4) superfamily, whose members show strong sequence similarity with some variability due to their distinct carbohydrate substrates. It includes bacterial poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB, hemin storage system HmsF protein in gram-negative species, intercellular adhesion proteins IcaB, and many uncharacterized prokaryotic polysaccharide deacetylases. It also includes a putative polysaccharide deacetylase YxkH encoded by the Bacillus subtilis yxkH gene, which is one of six polysaccharide deacetylase gene homologs present in the Bacillus subtilis genome. Sequence comparison shows all family members contain a conserved domain similar to the catalytic NodB homology domain of rhizobial NodB-like proteins, which consists of a deformed (beta/alpha)8 barrel fold with 6 or 7 strands. However, in this family, most proteins have 5 strands and some have 6 strands. Moreover, long insertions are found in many family members, whose function remains unknown.
cd10969	CE4_Ecf1_like_5s	4.09e-44	101	277	1	200	Putative catalytic NodB homology domain of a hypothetical protein Ecf1 from Escherichia coli and similar proteins. This family contains a hypothetical protein Ecf1 from Escherichia coli and its prokaryotic homologs. Although their biochemical properties remain to be determined, members in this family contain a conserved domain with a 5-stranded beta/alpha barrel, which is similar to the catalytic NodB homology domain of rhizobial NodB-like proteins, belonging to the larger carbohydrate esterase 4 (CE4) superfamily.
pfam01522	Polysacc_deac_1	6.35e-39	131	257	2	124	Polysaccharide deacetylase. This domain is found in polysaccharide deacetylase. This family of polysaccharide deacetylases includes NodB (nodulation protein B from Rhizobium) which is a chitooligosaccharide deacetylase. It also includes chitin deacetylase from yeast, and endoxylanases which hydrolyzes glucosidic bonds in xylan.
COG0726	CDA1	7.55e-36	80	258	1	184	Peptidoglycan/xylan/chitin deacetylase, PgdA/CDA1 family [Carbohydrate transport and metabolism, Cell wall/membrane/envelope biogenesis].
cd10966	CE4_yadE_5s	3.56e-34	134	287	1	164	Putative catalytic polysaccharide deacetylase domain of uncharacterized protein yadE and similar proteins. This family contains an uncharacterized protein yadE from Escherichia coli and its bacterial homologs. Although its molecular function remains unknown, yadE shows high sequence similarity with the catalytic NodB homology domain of outer membrane lipoprotein PgaB and the surface-attached protein intercellular adhesion protein IcaB. Both PgaB and IcaB are essential in bacterial biofilm formation.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QZY32711.1	1.30e-46	79	289	64	273
ADY56017.1	5.79e-39	79	287	85	293
AQS60291.1	3.30e-38	75	280	40	261
AEI34796.1	1.23e-33	74	280	25	233
AAK76800.1	1.23e-33	74	280	25	233

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6DQ3_A	1.55e-38	78	281	7	217	ChainA, Polysaccharide deacetylase [Streptococcus pyogenes],6DQ3_B Chain B, Polysaccharide deacetylase [Streptococcus pyogenes]
4V33_A	2.40e-20	77	289	141	357	Crystalstructure of the putative polysaccharide deacetylase BA0330 from bacillus anthracis [Bacillus anthracis],4V33_B Crystal structure of the putative polysaccharide deacetylase BA0330 from bacillus anthracis [Bacillus anthracis]
6GO1_A	7.29e-20	80	290	100	316	CrystalStructure of a Bacillus anthracis peptidoglycan deacetylase [Bacillus anthracis],6GO1_B Crystal Structure of a Bacillus anthracis peptidoglycan deacetylase [Bacillus anthracis]
4HD5_A	8.45e-20	77	289	141	357	CrystalStructure of BC0361, a polysaccharide deacetylase from Bacillus cereus [Bacillus cereus ATCC 14579]
5BU6_A	1.34e-10	82	263	15	247	Structureof BpsB deaceylase domain from Bordetella bronchiseptica [Bordetella bronchiseptica RB50],5BU6_B Structure of BpsB deaceylase domain from Bordetella bronchiseptica [Bordetella bronchiseptica RB50]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P94361	2.92e-49	1	295	1	275	Putative polysaccharide deacetylase YxkH OS=Bacillus subtilis (strain 168) OX=224308 GN=yxkH PE=3 SV=1
P31666	1.96e-12	80	279	170	390	Uncharacterized protein YadE OS=Escherichia coli (strain K12) OX=83333 GN=yadE PE=3 SV=2
Q04729	1.06e-10	127	255	58	184	Uncharacterized 30.6 kDa protein in fumA 3'region OS=Geobacillus stearothermophilus OX=1422 PE=3 SV=1
P75906	3.15e-08	83	280	52	293	Poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase OS=Escherichia coli (strain K12) OX=83333 GN=pgaB PE=1 SV=1
Q8XAR3	3.15e-08	83	280	52	293	Poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase OS=Escherichia coli O157:H7 OX=83334 GN=pgaB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000057	0.004555	0.995397	0.000006	0.000009	0.000005

TMHMM  Annotations     

start	end
5	22