CAZyme Information: MGYG000000147_03404

Basic Information

• Species: Bacillus paralicheniformis
• Lineage: Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus; Bacillus paralicheniformis
• CAZyme ID: MGYG000000147_03404
• CAZy Family: GH26
• CAZyme Description: Mannan endo-1,4-beta-mannosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
360	MGYG000000147_7|CGC2	40386.45	5.3674

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000147	4371304	Isolate	United Kingdom	Europe

• Gene Location: Start: 81146; End: 82228 Strand: -

Full Sequence      

MKKSIVCSIFALLLAFAVSQPSYAHTVSPVNPNAQPTTKAVMNWLAHLPNRTENRVMSGA
FGGYSLDTFSLAEADRIKQATGQLPAVYGCDYARGWLEPEEIADTIDYSCNSDLIAYWKS
GGIPQISLHLANPAFTSGHYKTQISNSQYERILDSSTPEGKRLEAMLSKIADGLQELENE
GVPVLFRPLHEMNGEWFWWGLTQYNQKDSARISLYKRLYVKIYDYMTKTRGLDHLLWVYA
PDANRDFKTDFYPGASYVDIVGLDAYFDDPHAIDGYDQLTSLNKPFAFTEVGPQTTNGGL
DYARFIHAIKEKYPNTTYFLAWNDGWSPAVNKGAGALYLHPWTLNKGDIWDGGSLTPVVE

Enzyme Prediction     

EC	3.2.1.78

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH26	30	347	1e-89	0.9933993399339934

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam02156	Glyco_hydro_26	1.54e-138	30	348	1	311	Glycosyl hydrolase family 26.
COG4124	ManB2	1.78e-94	2	360	6	355	Beta-mannanase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QFY39913.1	3.79e-276	1	360	1	360
AYQ15323.1	3.79e-276	1	360	1	360
ACX94049.1	3.79e-276	1	360	1	360
AGN35218.1	3.79e-276	1	360	1	360
ARA84663.1	2.19e-275	1	360	1	360

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2QHA_A	3.57e-214	25	360	1	336	FromStructure to Function: Insights into the Catalytic Substrate Specificity and Thermostability Displayed by Bacillus subtilis mannanase BCman [Bacillus subtilis],2QHA_B From Structure to Function: Insights into the Catalytic Substrate Specificity and Thermostability Displayed by Bacillus subtilis mannanase BCman [Bacillus subtilis]
3CBW_A	3.77e-214	17	360	2	345	ChainA, YdhT protein [Bacillus subtilis],3CBW_B Chain B, YdhT protein [Bacillus subtilis]
2WHK_A	3.88e-212	25	360	1	336	Structureof Bacillus subtilis mannanase man26 [Bacillus subtilis]
7EET_A	4.87e-121	26	349	9	345	ChainA, Mannanase KMAN [Klebsiella oxytoca]
6HF2_A	4.44e-29	68	296	78	297	Thestructure of BoMan26B, a GH26 beta-mannanase from Bacteroides ovatus [Bacteroides ovatus ATCC 8483],6HF4_A The structure of BoMan26B, a GH26 beta-mannanase from Bacteroides ovatus, complexed with G1M4 [Bacteroides ovatus ATCC 8483]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O05512	8.62e-215	2	360	3	362	Mannan endo-1,4-beta-mannosidase OS=Bacillus subtilis (strain 168) OX=224308 GN=gmuG PE=1 SV=2
P55278	6.38e-198	1	360	2	360	Mannan endo-1,4-beta-mannosidase OS=Bacillus subtilis OX=1423 PE=3 SV=1
P16699	5.20e-115	6	349	7	355	Mannan endo-1,4-beta-mannosidase A and B OS=Caldalkalibacillus mannanilyticus (strain DSM 16130 / CIP 109019 / JCM 10596 / AM-001) OX=1236954 PE=1 SV=1
A1A278	1.79e-23	13	347	24	376	Mannan endo-1,4-beta-mannosidase OS=Bifidobacterium adolescentis (strain ATCC 15703 / DSM 20083 / NCTC 11814 / E194a) OX=367928 GN=BAD_1030 PE=1 SV=1
Q5AWB7	1.82e-19	26	292	25	298	Probable mannan endo-1,4-beta-mannosidase E OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=manE PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000261	0.999023	0.000186	0.000168	0.000161	0.000149

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000147_03404.