CAZyme Information: MGYG000000147_00418

Basic Information

• Species: Bacillus paralicheniformis
• Lineage: Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus; Bacillus paralicheniformis
• CAZyme ID: MGYG000000147_00418
• CAZy Family: CE12
• CAZyme Description: putative rhamnogalacturonan acetylesterase YesY

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
214	MGYG000000147_1|CGC6	24308.7	7.3484

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000147	4371304	Isolate	United Kingdom	Europe

• Gene Location: Start: 403545; End: 404189 Strand: +

Full Sequence      

MTISIYLAGDSTVQNYKADSPQGGWGEFLQSYVSGNVQVINRAIGGRSSKTFVEEGRLAS
ILDVIKQNDWLFVQMGHNDASKDKPERYTEPYTTYKQYLKMYVDGARQKGASPLLITPVA
RLHYKDGVFLNDFPDYCIAMKQVASEENVRLIDLMDKSLQHFAEKGYSEVFKYFMISENV
NDYTHFTKKGAREMAKLVSIGIRELGLPFVKETV

Enzyme Prediction     

No EC number prediction in MGYG000000147_00418.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE12	5	199	7.6e-70	0.9761904761904762

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd01821	Rhamnogalacturan_acetylesterase_like	1.26e-94	5	202	3	198	Rhamnogalacturan_acetylesterase_like subgroup of SGNH-hydrolases. Rhamnogalacturan acetylesterase removes acetyl esters from rhamnogalacturonan substrates, and renders them susceptible to degradation by rhamnogalacturonases. Rhamnogalacturonans are highly branched regions in pectic polysaccharides, consisting of repeating -(1,2)-L-Rha-(1,4)-D-GalUA disaccharide units, with many rhamnose residues substituted by neutral oligosaccharides such as arabinans, galactans and arabinogalactans. Extracellular enzymes participating in the degradation of plant cell wall polymers, such as Rhamnogalacturonan acetylesterase, would typically be found in saprophytic and plant pathogenic fungi and bacteria.
COG2755	TesA	1.24e-32	5	206	11	212	Lysophospholipase L1 or related esterase [Amino acid transport and metabolism].
pfam00657	Lipase_GDSL	2.00e-16	5	198	1	224	GDSL-like Lipase/Acylhydrolase.
cd00229	SGNH_hydrolase	1.43e-15	5	198	1	184	SGNH_hydrolase, or GDSL_hydrolase, is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the typical Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.
pfam13472	Lipase_GDSL_2	1.22e-12	9	192	3	175	GDSL-like Lipase/Acylhydrolase family. This family of presumed lipases and related enzymes are similar to pfam00657.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAL46010.1	2.73e-155	1	214	1	214
AJO17719.1	2.73e-155	1	214	1	214
VEB18533.1	2.73e-155	1	214	1	214
QSF98232.1	4.52e-154	1	214	1	214
BCE12416.1	1.84e-153	1	214	1	214

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1DEO_A	1.24e-20	4	196	2	206	RHAMNOGALACTURONANACETYLESTERASE FROM ASPERGILLUS ACULEATUS AT 1.55 A RESOLUTION WITH SO4 IN THE ACTIVE SITE [Aspergillus aculeatus],1DEX_A RHAMNOGALACTURONAN ACETYLESTERASE FROM ASPERGILLUS ACULEATUS AT 1.9 A RESOLUTION [Aspergillus aculeatus],1K7C_A Rhamnogalacturonan acetylesterase with seven N-linked carbohydrate residues distributed at two N-glycosylation sites refined at 1.12 A resolution [Aspergillus aculeatus],1PP4_A The crystal structure of rhamnogalacturonan acetylesterase in space group P3121 [Aspergillus aculeatus],1PP4_B The crystal structure of rhamnogalacturonan acetylesterase in space group P3121 [Aspergillus aculeatus]
3C1U_A	6.57e-20	4	196	2	206	ChainA, Rhamnogalacturonan acetylesterase [Aspergillus aculeatus]
2O14_A	4.94e-18	4	207	164	364	X-RayCrystal Structure of Protein YXIM_BACsu from Bacillus subtilis. Northeast Structural Genomics Consortium Target SR595 [Bacillus subtilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31528	1.48e-115	1	214	1	214	Probable rhamnogalacturonan acetylesterase YesY OS=Bacillus subtilis (strain 168) OX=224308 GN=yesY PE=1 SV=1
O31523	2.85e-45	3	208	6	218	Rhamnogalacturonan acetylesterase RhgT OS=Bacillus subtilis (strain 168) OX=224308 GN=rhgT PE=1 SV=1
Q00017	6.63e-20	1	196	16	223	Rhamnogalacturonan acetylesterase OS=Aspergillus aculeatus OX=5053 GN=rha1 PE=1 SV=1
P42304	8.69e-19	4	207	179	379	Uncharacterized esterase YxiM OS=Bacillus subtilis (strain 168) OX=224308 GN=yxiM PE=1 SV=2
Q5BAA2	1.64e-14	4	195	19	217	Rhamnogalacturonan acetylesterase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=AN2528 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000075	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000147_00418.