CAZyme Information: MGYG000000147_00350

Basic Information

• Species: Bacillus paralicheniformis
• Lineage: Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus; Bacillus paralicheniformis
• CAZyme ID: MGYG000000147_00350
• CAZy Family: CBM50
• CAZyme Description: Cell wall-binding protein YocH

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
246	MGYG000000147_1|CGC5	26109.6	7.0233

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000147	4371304	Isolate	United Kingdom	Europe

• Gene Location: Start: 341804; End: 342544 Strand: +

Full Sequence      

MKKTIMSLAAAAAMSATAFGATASAKEIEVQKGDTLWGISQNYGMNLKDLKKWNQLSSDL
ILPGQKLNISSQEEKSEEKQYTVQPGDTLSKIAKEFGVTVSDLQKRNNLKSDLIIAGQTI
AINGEAGEAAAAAPVKQESAQKQNDQPVNVQKEITVTATAYTANDGGISGITKTGVDLNA
NRDAKVIAVDPSVIPLGTKVYVEGYGEATAEDTGGAIKGHKIDVFIPDKKDAFNWGVKTV
KVKILN

Enzyme Prediction     

No EC number prediction in MGYG000000147_00350.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3584	3D	4.65e-48	134	244	4	109	3D (Asp-Asp-Asp) domain [Function unknown].
cd14667	3D_containing_proteins	8.18e-39	156	245	1	90	Non-mltA associated 3D domain containing proteins, named for 3 conserved aspartate residues. This family contains the 3D domain, named for its 3 conserved aspartates, including similar uncharacterized proteins. These proteins contain the critical active site aspartate of mltA-like lytic transglycosylases where the 3D domain forms a larger domain with the N-terminal region. This domain is also found in conjunction with numerous other domains such as the Escherichia coli MltA, a membrane-bound lytic transglycosylase comprised of 2 domains separated by a large groove, where the peptidoglycan strand binds. Domain A is made up of an N-terminal and a C-terminal portion, corresponding to the 3D domain and Domain B is inserted within the linear sequence of domain A. MltA is distinct from other bacterial LTs, which are similar to each other. Escherichia coli peptidoglycan lytic transglycosylase (LT) initiates cell wall recycling in response to damage, during bacterial fission, and cleaves peptidoglycan (PG) to create functional spaces in its wall. PG chains (also known as murein), the major components of the bacterial cell wall, are comprised of alternating beta-1-4-linked N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), and lytic transglycosylases cleave this beta-1-4 bond.
cd14486	3D_domain	3.58e-26	156	245	1	104	3D domain, named for 3 conserved aspartate residues, is found in mltA-like lytic transglycosylases and numerous other contexts. This family contains the 3D domain, named for its 3 conserved aspartates. It is found in conjunction with numerous other domains such as MltA (membrane-bound lytic murein transglycosylase A). These aspartates are critical active site residues of mltA-like lytic transglycosylases. Escherichia coli peptidoglycan lytic transglycosylase (LT) initiates cell wall recycling in response to damage, during bacterial fission, and cleaves peptidoglycan (PG) to create functional spaces in its wall. MltA has 2 domains, separated by a large groove, where the peptidoglycan strand binds. The C-terminus has a double-psi beta barrel fold within the 3D domain, which forms the larger A domain along with the N-terminal region of Mlts, but is also found in various other domain architectures. Peptigoglycan (also known as murein) chains, the primary structural component of bacterial cells walls, are comprised of alternating beta-1-4-linked N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc); lytic transglycosylases (LTs) cleave this beta-1-4 bond. Typically, LTs are exolytic, releasing Metabolite 1 (GlcNAc-anhMurNAc-L-Ala-D-Glu-m-Dap-D-Ala-D-Ala) from the ends of the PG strands. In contrast, membrane-bound lytic murein transglycosylase E (MltE) is endolytic , cleaving in the middle of PG strands, with further processing to Metabolite 1 accomplished by other LTs. In E. coli, there are six membrane- bound LTs: MltA-MltF and soluble Slt70. Slt35 is a soluble fragment cleaved from MltB. Bacterial LTs are classified in 4 families: Family 1 includes slt70 MltC-MltF, Family 2 includes MltA, Family 3 includes MltB, and family 4 of bacteriophage origin. While most LTs are related members of the lysozyme-like lytic transglycosylase family, MltA represents a distinct fold and sequence conservation.
pfam06725	3D	4.91e-22	185	246	1	72	3D domain. This short presumed domain contains three conserved aspartate residues, hence the name 3D. It has been shown to be part of the catalytic double psi beta barrel domain of MltA.
PRK06347	PRK06347	2.83e-20	20	123	325	450	1,4-beta-N-acetylmuramoylhydrolase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QFY39357.1	4.98e-167	1	246	1	246
BCE06113.1	4.98e-167	1	246	1	246
AYQ15884.1	4.98e-167	1	246	1	246
BCE12341.1	4.98e-167	1	246	1	246
QEO06546.1	4.98e-167	1	246	1	246

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WLI_A	4.70e-14	156	245	16	113	StationaryPhase Survival Protein YuiC from B.subtilis [Bacillus subtilis subsp. subtilis str. 168]
4WLK_A	7.19e-14	156	245	37	134	StationaryPhase Survival Protein YuiC from B.subtilis complexed with reaction product [Bacillus subtilis subsp. subtilis str. 168],4WLK_B Stationary Phase Survival Protein YuiC from B.subtilis complexed with reaction product [Bacillus subtilis subsp. subtilis str. 168]
4WJT_A	7.33e-14	156	245	37	134	StationaryPhase Survival Protein YuiC from B.subtilis complexed with NAG [Bacillus subtilis subsp. subtilis str. 168],4WJT_B Stationary Phase Survival Protein YuiC from B.subtilis complexed with NAG [Bacillus subtilis subsp. subtilis str. 168]
2MKX_A	1.27e-06	81	122	7	48	Solutionstructure of LysM the peptidoglycan binding domain of autolysin AtlA from Enterococcus faecalis [Enterococcus faecalis V583]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O34669	5.50e-100	1	246	1	287	Cell wall-binding protein YocH OS=Bacillus subtilis (strain 168) OX=224308 GN=yocH PE=1 SV=1
P37546	1.53e-33	152	246	313	407	Putative cell wall shaping protein YabE OS=Bacillus subtilis (strain 168) OX=224308 GN=yabE PE=2 SV=2
P54421	1.93e-21	1	124	1	131	Probable peptidoglycan endopeptidase LytE OS=Bacillus subtilis (strain 168) OX=224308 GN=lytE PE=1 SV=1
O31852	2.78e-15	2	124	3	133	D-gamma-glutamyl-meso-diaminopimelic acid endopeptidase CwlS OS=Bacillus subtilis (strain 168) OX=224308 GN=cwlS PE=1 SV=1
Q5HRU2	7.92e-15	2	126	3	131	N-acetylmuramoyl-L-alanine amidase sle1 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) OX=176279 GN=sle1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000475	0.998434	0.000239	0.000322	0.000266	0.000205

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000147_00350.