CAZyme Information: MGYG000000146_01640

Basic Information

• Species: Dorea formicigenerans
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Dorea; Dorea formicigenerans
• CAZyme ID: MGYG000000146_01640
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
334	MGYG000000146_3|CGC3	36765.6	7.4114

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000146	3357413	Isolate	United Kingdom	Europe

• Gene Location: Start: 220743; End: 221747 Strand: +

Full Sequence      

MKLKHFAVFGGIFTVIICLLLFLFIVTADDEESGASNFDFSGLNLSQEVLKHQPTVEKYA
KEYGISDYVNYLLAIMQVESGGTGTTDVMQASESLGLPLNSLSVEESIKQGCKYFSELLK
SAESKGCDINTVVQAYNYGGGFIDYVAKHGKKYTFELAVSFAKDKSGGVKVTYKNEIAIK
ENGGWRYKYGNMFYVKLVSQYLAVPSFSDATAQAIFNEALKYQGWKYVFGGSNPNTSFDC
SGLVQWCYGKAGISLPRTAQAQYDATQHITLSQAKTGDLVFFHSTYNAGTYVTHVGIYAG
NNRMYHAGDPIGYADLTGSYWQQHLIGAGRVKTK

Enzyme Prediction     

No EC number prediction in MGYG000000146_01640.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam13702	Lysozyme_like	8.36e-78	46	202	1	165	Lysozyme-like.
cd16891	CwlT-like	6.09e-75	52	203	1	151	CwlT-like N-terminal lysozyme domain and similar domains. CwlT is a bifunctional cell wall hydrolase containing an N-terminal lysozyme domain and a C-terminal NlpC/P60 endopeptidase domain (gamma-d-D-glutamyl-L-diamino acid endopeptidase), and has been implicated in the spread of transposons. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, as well as the eukaryotic "goose-type" lysozymes (goose egg-white lysozyme; GEWL).
pfam00877	NLPC_P60	4.83e-37	224	330	1	105	NlpC/P60 family. The function of this domain is unknown. It is found in several lipoproteins.
PRK13914	PRK13914	8.76e-36	208	331	362	481	invasion associated endopeptidase.
COG0791	Spr	8.49e-28	203	328	63	196	Cell wall-associated hydrolase, NlpC family [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBL37506.1	6.61e-232	1	333	1	333
ALU16411.1	4.99e-227	1	333	1	333
QIB54707.1	7.08e-227	1	334	1	334
QMW79222.1	7.08e-227	1	334	1	334
CBL22199.1	1.38e-226	1	334	1	333

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4HPE_A	2.16e-163	28	332	4	307	ChainA, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_B Chain B, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_C Chain C, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_D Chain D, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_E Chain E, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_F Chain F, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630]
4FDY_A	4.18e-148	29	331	2	310	ChainA, Similar to lipoprotein, NLP/P60 family [Staphylococcus aureus subsp. aureus Mu50],4FDY_B Chain B, Similar to lipoprotein, NLP/P60 family [Staphylococcus aureus subsp. aureus Mu50]
7CFL_A	1.24e-15	212	331	14	137	ChainA, Putative cell wall hydrolase phosphatase-associated protein [Clostridioides difficile],7CFL_B Chain B, Putative cell wall hydrolase phosphatase-associated protein [Clostridioides difficile],7CFL_C Chain C, Putative cell wall hydrolase phosphatase-associated protein [Clostridioides difficile],7CFL_D Chain D, Putative cell wall hydrolase phosphatase-associated protein [Clostridioides difficile]
2K1G_A	3.60e-13	215	334	9	126	SolutionNMR structure of lipoprotein spr from Escherichia coli K12. Northeast Structural Genomics target ER541-37-162 [Escherichia coli K-12]
6BIQ_A	4.46e-13	224	307	167	250	Structureof NlpC2 from Trichomonas vaginalis [Trichomonas vaginalis],6BIQ_B Structure of NlpC2 from Trichomonas vaginalis [Trichomonas vaginalis],6BIQ_C Structure of NlpC2 from Trichomonas vaginalis [Trichomonas vaginalis],6BIQ_D Structure of NlpC2 from Trichomonas vaginalis [Trichomonas vaginalis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P96645	5.69e-76	30	332	38	329	Probable endopeptidase YddH OS=Bacillus subtilis (strain 168) OX=224308 GN=yddH PE=3 SV=1
P21171	7.88e-25	215	331	372	484	Probable endopeptidase p60 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) OX=169963 GN=iap PE=1 SV=2
Q01836	4.52e-24	214	331	354	467	Probable endopeptidase p60 OS=Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262) OX=272626 GN=iap PE=3 SV=2
Q01839	4.62e-24	218	331	415	524	Probable endopeptidase p60 OS=Listeria welshimeri OX=1643 GN=iap PE=3 SV=1
Q01837	5.34e-23	214	331	411	524	Probable endopeptidase p60 OS=Listeria ivanovii OX=1638 GN=iap PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.987648	0.010889	0.001223	0.000032	0.000021	0.000213

TMHMM  Annotations     

start	end
5	27