CAZyme Information: MGYG000000145_01966

Basic Information

• Species: Lacrimispora sp902363735
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Lacrimispora; Lacrimispora sp902363735
• CAZyme ID: MGYG000000145_01966
• CAZy Family: GT4
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1088	MGYG000000145_4|CGC2	125809.29	6.7029

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000145	4646417	Isolate	United Kingdom	Europe

• Gene Location: Start: 66839; End: 70105 Strand: -

Full Sequence      

MYMQKIEERINLLLKKCEALGLDPVHGLKQTVSRTFSLDRKELKELRLACIADRFTSDSY
RPECNLLELTPDAWHKELEAFGADIVFVESAWEGKDKLWYRKIANGSKQLYELCTYCHEK
KIPVIFWNKEDPVYTDTFMSAAQLADFVFTTDIDCIPIYKANLMHDRVYHLHFAAQPALH
NPIEKFSRKDKFCFAGAYYHRYPKRTQVFDAFADVFIEGKGFEIYDRNYKSSRPEHAFPA
KYNPYILGNLDPSQIEVAYKGYEYGVNMNSIDQSQTMFARRVFEMLASNTVTIGNYSRGV
KNYFGDLTICTNDKIYLDSCIKEYCTDSNTLAKYKLAGLRKVLSQHLYEDRLDYIVCKVF
GRSLKRSLPSAVVFAYVEQDTEAQRVAEMFRAQRYTDKKLYMFGNGAFEIPDQHIFVWKE
SDTLAQISEDAYVGFMDFQSYYGSYYLTDLMLTLRYYSCDGIGKGGFYSYQNGEFVCNER
VKVYRTSDSLCLVRSLIKRQALPSMNIRVLWEDNVIQGMFFCTDMLHYCKDFTGYSCEWV
DDLKIPDQGLEMQSIEKLAESIAIPAIKYDCLQLMSKDIAELVNNSTQRKVQTKQEGERF
LISSDLAPDENTYIHINRLYSASQFVKEGKLTIQFKGNGDLDIIGSCLFFDQKGNPLPNS
FGKPNCTLSFDVPIGAASFKLALRIKGAGNFYVLGIDIGEAFTRSLSTFVCRSGTLVLTN
IYPQSDNLYRNMFVHQRVLSYKQQDSLCDIMCMNIYATDQKREFEGINIVEGQSAMLESI
LSSGQINTVCVHFLDPIMWEILQRFGKQIRILVWLHGSEIQPWWRREYNYENKKELEKAK
QASDIRMKFWKEVFSKVDDMNIHFIFVSKYFADEVFEDNQVCLRPEKMSIIHNAISTSLF
RYIPKEEEQRMKLLSIRPYASNKYANDLTVKCIIELSKRSFFKDLEICLIGSGELFDETL
RPLRKFKNIKIEKGFLTQTQIAQVHLSYGVFLTPTRMDAQGVSRDEAMSSGLVPVTNAVT
AIPEFVDENCAILAPAEDYMAMAEGIERLYYNPDLFLKLSENAARRVRIQTSPEYTIMRE
VKLIYGGR

Enzyme Prediction     

No EC number prediction in MGYG000000145_01966.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03801	GT4_PimA-like	2.21e-18	789	1084	86	365	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
COG0438	RfaB	1.81e-16	786	1084	89	374	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
cd03825	GT4_WcaC-like	1.87e-13	812	1067	79	344	putative colanic acid biosynthesis glycosyl transferase WcaC and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. Escherichia coli WcaC has been predicted to function in colanic acid biosynthesis. WcfI in Bacteroides fragilis has been shown to be involved in the capsular polysaccharide biosynthesis.
COG4641	COG4641	2.45e-11	79	356	74	356	Spore maturation protein CgeB [Cell cycle control, cell division, chromosome partitioning].
cd03794	GT4_WbuB-like	2.73e-11	826	1067	131	377	Escherichia coli WbuB and similar proteins. This family is most closely related to the GT1 family of glycosyltransferases. WbuB in E. coli is involved in the biosynthesis of the O26 O-antigen. It has been proposed to function as an N-acetyl-L-fucosamine (L-FucNAc) transferase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIY81850.1	0.0	36	1084	45	1099
ALS25943.1	6.70e-285	3	1084	10	1097
BAJ00592.1	1.66e-284	39	1084	157	1216
QDG76712.1	7.91e-280	41	1084	248	1310
SDS87966.1	3.28e-277	28	1083	541	1608

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000035	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000145_01966.