CAZyme Information: MGYG000000145_01359

Basic Information

• Species: Lacrimispora sp902363735
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Lacrimispora; Lacrimispora sp902363735
• CAZyme ID: MGYG000000145_01359
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YteR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
378	MGYG000000145_2|CGC4	44143.13	4.7102

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000145	4646417	Isolate	United Kingdom	Europe

• Gene Location: Start: 408358; End: 409494 Strand: +

Full Sequence      

MDVIERYINELMEKSTPDRPVWNIEKILQGEKAGWNYIDGCMIKAILEMYAITRDLKYLE
FADTFIDFRVREDGTIDGYDVEELNIDNVNAGKTLFELYDLTGKEKYRTAIELVYSQIKK
MPRTAEGNFWHKNIYPNQVWLDGLYMCQPFYMEYETRFHNRKNCPDIYRQFDSVVKHMQD
SETGLYYHAYDSSREMFWCDKVTGLSQNFWLRALGWYSMALLDTMDKAGKEDQESLKKME
EAFKDLIDSIIKYQDESGMWYQVVNLGGMDGNYLETSGSAIFSYAILKGVRLGYLDQSYE
NYGKMAFEGICRKYLSLEDGNMSLGGICLVAGLGGKERRDGTYRYYMSEPIVKDDAKGVG
PFLLAYTEMRRAGWEYKN

Enzyme Prediction     

No EC number prediction in MGYG000000145_01359.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	31	370	7.4e-116	0.9698795180722891

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4225	YesR	5.22e-96	32	372	31	356	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
pfam07470	Glyco_hydro_88	3.94e-84	32	371	24	341	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SET55199.1	1.64e-245	1	378	1	378
AEN96572.1	1.91e-221	1	373	1	374
CBL12002.1	8.09e-220	1	371	1	372
CBL09353.1	2.32e-219	1	371	1	372
VCV21981.1	1.34e-218	1	371	1	372

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WU0_A	7.34e-105	35	368	23	357	StructuralAnalysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]
1NC5_A	1.05e-69	35	369	39	364	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	4.40e-69	35	369	29	354	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]
3PMM_A	4.13e-13	33	310	64	329	ChainA, Putative cytoplasmic protein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
3QWT_A	5.68e-12	33	318	63	335	ChainA, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O34559	5.73e-69	35	369	39	364	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
P0A3U6	1.89e-41	149	368	4	227	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1
P0A3U7	1.89e-41	149	368	4	227	24.9 kDa protein in picA locus OS=Rhizobium radiobacter OX=358 PE=2 SV=1
O31521	8.15e-23	35	292	29	274	Unsaturated rhamnogalacturonyl hydrolase YesR OS=Bacillus subtilis (strain 168) OX=224308 GN=yesR PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000059	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000145_01359.