CAZyme Information: MGYG000000144_02310

Basic Information

• Species: Barnesiella intestinihominis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Barnesiellaceae; Barnesiella; Barnesiella intestinihominis
• CAZyme ID: MGYG000000144_02310
• CAZy Family: CBM35
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
662	MGYG000000144_4|CGC4	74777.52	5.9404

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000144	3314966	Isolate	United Kingdom	Europe

• Gene Location: Start: 227487; End: 229475 Strand: +

Full Sequence      

MRRKICVVTLFLVFIGQIVMAGGNTADFKYGKWHLKYTLSTGSAEYIYQGKTVFDKVGTG
VSGTYTEYEIGQEEITDGFGTGMCFTVTRSGENLPSVIQRFFLYEGKDYFLTDVALSDEK
GVETNYLRPISTEPDTRCDILGKGDNRVLIVPFDNDKWVRYRSSDLRGGVNSFEVSAVYN
ADTRRGIVIGSVEHDTWKSGVRIESDEPGIISRLELYTGASGEGTRDVLPHGKVKGKTVR
SPKTFFGYFEDWRDGMEEFGRACATIAPPLPWNLGTPFGWNSWAKMEFRLSYEKVLEVSD
FFKENLQNNNFENNGIVYIGMDAGWAKMSDEQLADIARHCKANGQKAGIYFTPFSDWGKD
PEAYINGNSGYKCKDAYLYANGKTQNMVAGGLAMDPTHPAIKERIRETAERFKRLGYEYI
KIDFLTHGCAEADYYYDPEVQTGMQAYNKGMAYLLEQMEGMYITMAISPLFPSQYAHSRR
IACDAWAGIGDTEYTLNSLTYGWWLNQVYTYNDPDHLLLEPVSDGENRARITSGVITGIF
MNGDDLSYISGIQVAKDKARKFLTNEDINAIAKMGKSFRPVNGNMDGADFLFMHDTGKEV
YLTAFNYSGYDLTYDLPLSRLGLRESSTYKAKELWSGKEVKFKKNVRVCIPKKDVLVFRI
TR

Enzyme Prediction     

No EC number prediction in MGYG000000144_02310.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd14791	GH36	1.99e-18	277	560	3	293	glycosyl hydrolase family 36 (GH36). GH36 enzymes occur in prokaryotes, eukaryotes, and archaea with a wide range of hydrolytic activities, including alpha-galactosidase, alpha-N-acetylgalactosaminidase, stachyose synthase, and raffinose synthase. All GH36 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH36 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.
cd14792	GH27	1.43e-07	277	571	2	268	glycosyl hydrolase family 27 (GH27). GH27 enzymes occur in eukaryotes, prokaryotes, and archaea with a wide range of hydrolytic activities, including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-N-acetylgalactosaminidase, and 3-alpha-isomalto-dextranase. All GH27 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH27 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.
pfam17801	Melibiase_C	1.01e-06	599	660	15	74	Alpha galactosidase C-terminal beta sandwich domain. This domain is found at the C-terminus of alpha galactosidase enzymes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QJR78498.1	3.60e-218	16	660	22	673
QJR69930.1	5.10e-218	16	660	22	673
AII65845.1	5.10e-218	16	660	22	673
QJR74262.1	5.10e-218	16	660	22	673
QJR65668.1	5.10e-218	16	660	22	673

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000573	0.998425	0.000290	0.000224	0.000221	0.000211

TMHMM  Annotations     

start	end
7	26