CAZyme Information: MGYG000000144_02307

Basic Information

• Species: Barnesiella intestinihominis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Barnesiellaceae; Barnesiella; Barnesiella intestinihominis
• CAZyme ID: MGYG000000144_02307
• CAZy Family: CBM35
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
785	MGYG000000144_4|CGC4	88078.94	5.2639

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000144	3314966	Isolate	United Kingdom	Europe

• Gene Location: Start: 221184; End: 223541 Strand: +

Full Sequence      

MNRLTSLLFCVIPLSVSAITVQEGMLKLNISDTDGQTDIYRNEVLLISKNHAVFKIDESE
YSAPSLTFTGATVSDYSDLFGLGKRVDLVYTNENPKLKATHTYYLYSGQNYLLTELKVEA
PDVIASNYMSPLTTTEPTAFLPAENGTNVALIVPYDNDCWVAYDSKVFRVGATYTSYEAG
CLYSTKNNNGLVLGSIEHDNWKTGVVSKVNTPNSITSLIVYGGISDNYSGKTPTTRDQLP
HGKVKGTTVKSPKVMIGYFDDWRDGMEVYGELNAVVTPKRAWDKGTPFGWNSWGNAMSDV
SYAIASSVSAFFADKLAPEFTNDSTVYIGLDSYWTNITAQNRRRFIKECKERGQRPGIYW
TPFVDWGGNMNKDVEGTNGKYKYGDIVLKINGQPAQFPGGNKGWALDPTHIGTKMRIDYY
IDQWIKDGYEFLKIDFMTHGTFEADSWYDPEVTTGIQAYNQGMKYLSDRIGDKMYVNLSI
APLFPAQYANGRRFACDTYGTMNDTKYALNALTHSWWTDRFYCYNDPDYMVFGKFTGNGE
YPSGRTYTLHSPGENRARFTSVVTTGLCLLGDDFLNCTEEARVRAQSIVKNEEINRIGKI
GKSFRPIVNDYWGTGQADAFMHRVADTLYVAAYHFTTSPTQKVFNLKYSDLGLAEGVVYT
VHELWTDKKEMTDKTANILTLKVPRSDARVFKIYPGTISSVEEAVADKDTKIYPNPCHDE
LYINKLNNENNCDYDVYSIAGEKLISLDDFGGDVIDVNPLAPGSYILVSTDTVTRNRFVA
SFIKE

Enzyme Prediction     

No EC number prediction in MGYG000000144_02307.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd14791	GH36	1.34e-10	287	586	3	293	glycosyl hydrolase family 36 (GH36). GH36 enzymes occur in prokaryotes, eukaryotes, and archaea with a wide range of hydrolytic activities, including alpha-galactosidase, alpha-N-acetylgalactosaminidase, stachyose synthase, and raffinose synthase. All GH36 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH36 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.
TIGR04183	Por_Secre_tail	6.11e-07	712	774	1	64	Por secretion system C-terminal sorting domain. Species that include Porphyromonas gingivalis, Fibrobacter succinogenes, Flavobacterium johnsoniae, Cytophaga hutchinsonii, Gramella forsetii, Prevotella intermedia, and Salinibacter ruber average twenty or more copies of a C-terminal domain, represented by this model, associated with sorting to the outer membrane and covalent modification.
pfam18962	Por_Secre_tail	3.50e-04	712	772	1	63	Secretion system C-terminal sorting domain. Species that include Porphyromonas gingivalis, Fibrobacter succinogenes, Flavobacterium johnsoniae, Cytophaga hutchinsonii, Gramella forsetii, Prevotella intermedia, and Salinibacter ruber have on average twenty or more copies of this C-terminal domain, associated with sorting to the outer membrane and covalent modification. This domain targets proteins to type IX secretion systems and is secreted then cleaved off by a C-terminal signal peptidease. Based on similarity to other families it is likely that this domain adopts an immunoglobulin like fold.
cd14792	GH27	3.67e-04	287	594	2	265	glycosyl hydrolase family 27 (GH27). GH27 enzymes occur in eukaryotes, prokaryotes, and archaea with a wide range of hydrolytic activities, including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-N-acetylgalactosaminidase, and 3-alpha-isomalto-dextranase. All GH27 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH27 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.
pfam17801	Melibiase_C	0.001	645	693	30	74	Alpha galactosidase C-terminal beta sandwich domain. This domain is found at the C-terminus of alpha galactosidase enzymes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AII65845.1	5.13e-158	4	693	8	673
QJR78498.1	1.02e-157	4	693	8	673
QJR69930.1	2.03e-157	4	693	8	673
QJR74262.1	2.03e-157	4	693	8	673
QJR65668.1	2.03e-157	4	693	8	673

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000336	0.998846	0.000219	0.000199	0.000190	0.000172

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000144_02307.