CAZyme Information: MGYG000000144_01947

Basic Information

• Species: Barnesiella intestinihominis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Barnesiellaceae; Barnesiella; Barnesiella intestinihominis
• CAZyme ID: MGYG000000144_01947
• CAZy Family: GH89
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
722	MGYG000000144_3|CGC4	83266	4.6605

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000144	3314966	Isolate	United Kingdom	Europe

• Gene Location: Start: 297903; End: 300071 Strand: +

Full Sequence      

MKYHISSSLFVLFCIVLCACNSSSVEKDGIIQPAFDLIERQIGERVADIQLEEIAPENGK
ETFEVEAKNGILTLRGSSSVAICYAFYTYLREACSAMKTWSGERMELPETWPDFVLKKQT
TPYEYRYFLNVCTFGYTTPYWDWERWEKEIDWMALRGVNMPLATVASEAIAERVWLKMGL
KEEDIRAFFTGPAHLPWHRMGNLNGWDGPLTDGWQKEQIKLQHKILNRMRELGMEPIAPA
FAGFVPTAFAERHPEIQFKHLEWGGFDEKYNAYVLPPETPYFKEIGKLFIEEWEKEFGKN
TYYLSDSFNEMKLPVAEGDDDGKHKLLAQYGESIYHSIAAGNPDAVWVTQGWTFGYQHDF
WDKASLQALLSRVPDDKMIIIDLGNDYPKWVWGTEQTWKNHDGFYGKKWIFSYVPNFGGK
TPMTGDLQMYATSSAEALHSANAGNLIGFGSAPEGLENNEVIYELLADMGWTADSIDLDS
WLPVYCKARYGGCPAAMDSAWQRFRETAYSSLYSYPRFTWQTVVPDTRRISKLDVSDSFL
QGVELFLSCADSLESSSLYVNDAIEYASYYLAAKADDCYKRALKEDSLGNRVAAMQQLDR
SVEILLDVDKLLASHPLYRLEEWVDMARDWGKTDLEKDAYEANAKRLITTWGGFQEDYAA
RFWSGLIKDYYIPRMKLYFSEQRADLNRWEENWIKAPWHNTSTSFEDPLQSAIKLVERYK
EE

Enzyme Prediction     

No EC number prediction in MGYG000000144_01947.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH89	69	711	4.8e-212	0.9622926093514329

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam05089	NAGLU	1.87e-178	126	473	1	333	Alpha-N-acetylglucosaminidase (NAGLU) tim-barrel domain. Alpha-N-acetylglucosaminidase, a lysosomal enzyme required for the stepwise degradation of heparan sulfate. Mutations on the alpha-N-acetylglucosaminidase (NAGLU) gene can lead to Mucopolysaccharidosis type IIIB (MPS IIIB; or Sanfilippo syndrome type B) characterized by neurological dysfunction but relatively mild somatic manifestations. The structure shows that the enzyme is composed of three domains. This central domain has a tim barrel fold.
pfam12972	NAGLU_C	3.69e-45	481	712	1	257	Alpha-N-acetylglucosaminidase (NAGLU) C-terminal domain. Alpha-N-acetylglucosaminidase, a lysosomal enzyme required for the stepwise degradation of heparan sulfate. Mutations on the alpha-N-acetylglucosaminidase (NAGLU) gene can lead to Mucopolysaccharidosis type IIIB (MPS IIIB; or Sanfilippo syndrome type B) characterized by neurological dysfunction but relatively mild somatic manifestations. The structure shows that the enzyme is composed of three domains. This C-terminal domain has an all alpha helical fold.
pfam12971	NAGLU_N	1.03e-25	32	112	1	81	Alpha-N-acetylglucosaminidase (NAGLU) N-terminal domain. Alpha-N-acetylglucosaminidase, a lysosomal enzyme required for the stepwise degradation of heparan sulfate. Mutations on the alpha-N-acetylglucosaminidase (NAGLU) gene can lead to Mucopolysaccharidosis type IIIB (MPS IIIB; or Sanfilippo syndrome type B) characterized by neurological dysfunction but relatively mild somatic manifestations. The structure shows that the enzyme is composed of three domains. This N-terminal domain has an alpha-beta fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AHF12618.1	0.0	1	722	1	722
QUT77130.1	0.0	19	721	19	720
ALJ47490.1	0.0	1	718	1	715
QRQ58948.1	0.0	1	718	1	715
SCV06900.1	0.0	1	718	1	715

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4XWH_A	3.30e-122	54	680	33	657	Crystalstructure of the human N-acetyl-alpha-glucosaminidase [Homo sapiens]
2VC9_A	5.74e-93	21	687	161	829	Family89 Glycoside Hydrolase from Clostridium perfringens in complex with 2-acetamido-1,2-dideoxynojirmycin [Clostridium perfringens],2VCA_A Family 89 glycoside hydrolase from Clostridium perfringens in complex with beta-N-acetyl-D-glucosamine [Clostridium perfringens],2VCB_A Family 89 Glycoside Hydrolase from Clostridium perfringens in complex with PUGNAc [Clostridium perfringens],2VCC_A Family 89 Glycoside Hydrolase from Clostridium perfringens [Clostridium perfringens]
7MFK_A	6.64e-93	21	687	169	837	ChainA, Alpha-N-acetylglucosaminidase family protein [Clostridium perfringens ATCC 13124],7MFL_A Chain A, Alpha-N-acetylglucosaminidase family protein [Clostridium perfringens ATCC 13124]
4A4A_A	6.24e-92	21	687	184	852	CpGH89(E483Q, E601Q), from Clostridium perfringens, in complex with its substrate GlcNAc-alpha-1,4-galactose [Clostridium perfringens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P54802	4.67e-121	54	680	56	680	Alpha-N-acetylglucosaminidase OS=Homo sapiens OX=9606 GN=NAGLU PE=1 SV=2
Q9FNA3	4.84e-114	22	703	41	782	Alpha-N-acetylglucosaminidase OS=Arabidopsis thaliana OX=3702 GN=NAGLU PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000068	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000144_01947.